Transglutaminase 2/TGM2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Analysis in human placenta and testis tissues. Corresponding TGM2 RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Staining of human endometrium, fallopian tube, placenta and testis using Anti-TGM2 antibody NBP1-86951 (A) ...read more
Independent Antibodies: Western Blot: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Analysis using Anti-TGM2 antibody NBP1-86951 (A) shows similar pattern to independent antibody NBP1-86952 (B).
Immunocytochemistry/ Immunofluorescence: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Staining of human endometrium shows moderate cytoplasmic positivity in stromal cells.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in stromal cells.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Transglutaminase 2/TGM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Transglutaminase 2/TGM2 Protein (NBP1-86951PEP)
Publications
Read Publications using NBP1-86951.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22294552)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transglutaminase 2/TGM2 Antibody

  • C polypeptide
  • EC 2.3.2.13
  • G-ALPHA-h
  • protein-glutamine gamma-glutamyltransferase 2
  • protein-glutamine-gamma-glutamyltransferase
  • TG(C)
  • TG2
  • TGase C
  • TGase H
  • TGase-2
  • TGase-H
  • TGC
  • TGCGNAH
  • TGM2
  • Tissue transglutaminase
  • transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
  • Transglutaminase 2
  • Transglutaminase C
  • Transglutaminase H
  • transglutaminase-2
  • tTG

Background

TGase II is implicated in programmed cell death, signal transduction, drugresistance, cell growth, endocytosis, insulin secretion, cell adhesion, cataract formation, and wound healing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Transglutaminase 2/TGM2 Antibody (NBP1-86951)(2)

Reviews for Transglutaminase 2/TGM2 Antibody (NBP1-86951) (0)

There are no reviews for Transglutaminase 2/TGM2 Antibody (NBP1-86951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transglutaminase 2/TGM2 Antibody (NBP1-86951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Transglutaminase 2/TGM2 Products

Research Areas for Transglutaminase 2/TGM2 Antibody (NBP1-86951)

Find related products by research area.

Blogs on Transglutaminase 2/TGM2

There are no specific blogs for Transglutaminase 2/TGM2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Transglutaminase 2/TGM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGM2