Transglutaminase 2/TGM2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TGM2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Reactivity reported in scientific literature (PMID: 22294552)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Transglutaminase 2/TGM2 Antibody - BSA Free
Background
TGase II is implicated in programmed cell death, signal transduction, drugresistance, cell growth, endocytosis, insulin secretion, cell adhesion, cataract formation, and wound healing.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for Transglutaminase 2/TGM2 Antibody (NBP1-86951)(2)
Showing Publications 1 -
2 of 2.
Reviews for Transglutaminase 2/TGM2 Antibody (NBP1-86951) (0)
There are no reviews for Transglutaminase 2/TGM2 Antibody (NBP1-86951).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Transglutaminase 2/TGM2 Antibody (NBP1-86951) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Transglutaminase 2/TGM2 Products
Research Areas for Transglutaminase 2/TGM2 Antibody (NBP1-86951)
Find related products by research area.
|
Blogs on Transglutaminase 2/TGM2