Transferrin Antibody

Immunohistochemistry-Paraffin: Transferrin Antibody [NBP1-87222] - Staining of human colon, liver, lymph node and ovary using Anti-TF antibody NBP1-87222 (A) shows similar protein distribution across tissues to independent antibody NBP1-87221 (B).

Western Blot: Transferrin Antibody [NBP1-87222] - Analysis using Anti-TF antibody NBP1-87222 (A) shows similar pattern to independent antibody NBP1-87221 (B).

Immunohistochemistry-Paraffin: Transferrin Antibody [NBP1-87222] - Staining of human liver.

Western Blot: Transferrin Antibody [NBP1-87222] - Analysis in human cell line HepG2.

Immunohistochemistry-Paraffin: Transferrin Antibody [NBP1-87222] - Staining of human lymph node.

Immunohistochemistry-Paraffin: Transferrin Antibody [NBP1-87222] - Staining of human ovary.

Immunohistochemistry-Paraffin: Transferrin Antibody [NBP1-87222] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Transferrin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Transferrin Protein (NBP1-87222PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Transferrin Antibody

• Beta-1 metal-binding globulin
• DKFZp781D0156
• EC 3.4.21
• PRO1557
• PRO2086
• Serotransferrin
• Siderophilin
• TF
• Transferrin

Background

Transferrin is a single polypeptide chain glycoprotein and is a member of the iron binding family of proteins. It has a molecular weight of 77 kDa and a serum concentration range of 1800 to 2700 mg/L. It is synthesised in the liver and consists of two domains each having a high affinity reversible binding site for Fe3+. The iron is transported in blood and interstitial fluids to sites of use and disposal. Iron/transferrin is essential in haemoglobin synthesis and for certain types of cell division. Serum concentration rises in iron deficiency and pregnancy and falls in iron overload, infection and inflammatory conditions. The function of transferrin is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. In addition to its function in iron transport, this protein may also have a physiologic role as granulocyte/pollen binding protein (GPBP) involved in the removal of certain organic matter/allergins from serum.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Transferrin Antibody (NBP1-87222)(1)

Publication using NBP1-87222

• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

Bioinformatics

• Gene Symbol: TF