TRAM1 Antibody

Images

 
Immunohistochemistry-Paraffin: TRAM1 Antibody [NBP1-80669] - Staining of human vulva/anal skin shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNK
Specificity
Specificity of human TRAM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Colon Lysate (NB820-59205)
Liver Lysate (NB820-60599)
A-431 Lysate (NBL1-26466)
Control Peptide
TRAM1 Protein (NBP1-80669PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAM1 Antibody

  • PNAS8
  • PRO1292
  • TRAMP
  • TRAMtranslocating chain-associated membrane protein 1
  • translocating chain-associating membrane protein
  • translocation associated membrane protein 1
  • translocation-associating membrane protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-314
Species: Hu
Applications: WB, IP
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56722
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC-P, IP, B/N, Flow-CS
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB300-891
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for TRAM1 Antibody (NBP1-80669) (0)

There are no publications for TRAM1 Antibody (NBP1-80669).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAM1 Antibody (NBP1-80669) (0)

There are no reviews for TRAM1 Antibody (NBP1-80669). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRAM1 Antibody (NBP1-80669) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TRAM1 Antibody (NBP1-80669)

Discover related pathways, diseases and genes to TRAM1 Antibody (NBP1-80669). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAM1 Antibody (NBP1-80669)

Discover more about diseases related to TRAM1 Antibody (NBP1-80669).
 

Pathways for TRAM1 Antibody (NBP1-80669)

View related products by pathway.

PTMs for TRAM1 Antibody (NBP1-80669)

Learn more about PTMs related to TRAM1 Antibody (NBP1-80669).

Blogs on TRAM1

There are no specific blogs for TRAM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAM1