TRAM1 Antibody


Immunohistochemistry-Paraffin: TRAM1 Antibody [NBP1-80669] - Staining of human vulva/anal skin shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TRAM1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNK
Specificity of human TRAM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Colon Lysate (NB820-59205)
Liver Lysate (NB820-60599)
A-431 Lysate (NBL1-26466)
Control Peptide
TRAM1 Protein (NBP1-80669PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TRAM1 Antibody

  • PNAS8
  • PRO1292
  • TRAMtranslocating chain-associated membrane protein 1
  • translocating chain-associating membrane protein
  • translocation associated membrane protein 1
  • translocation-associating membrane protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IP, B/N, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for TRAM1 Antibody (NBP1-80669) (0)

There are no publications for TRAM1 Antibody (NBP1-80669).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAM1 Antibody (NBP1-80669) (0)

There are no reviews for TRAM1 Antibody (NBP1-80669). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRAM1 Antibody (NBP1-80669) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TRAM1 Antibody (NBP1-80669)

Discover related pathways, diseases and genes to TRAM1 Antibody (NBP1-80669). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAM1 Antibody (NBP1-80669)

Discover more about diseases related to TRAM1 Antibody (NBP1-80669).

Pathways for TRAM1 Antibody (NBP1-80669)

View related products by pathway.

PTMs for TRAM1 Antibody (NBP1-80669)

Learn more about PTMs related to TRAM1 Antibody (NBP1-80669).

Blogs on TRAM1

There are no specific blogs for TRAM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRAM1 Antibody and receive a gift card or discount.


Gene Symbol TRAM1