TRAF3IP2 Antibody - BSA Free

Western Blot: TRAF3IP2 Antibody [NBP3-38330] - Western blot analysis of lysates from Rat lung, using TRAF3IP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Western Blot: TRAF3IP2 Antibody [NBP3-38330] - Western blot analysis of various lysates using TRAF3IP2 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: TRAF3IP2 Antibody [NBP3-38330] - Immunofluorescence analysis of Hep G2 cells using TRAF3IP2 Rabbit pAbat a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRAF3IP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAF3IP2 Antibody - BSA Free (NBP3-38330) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human TRAF3IP2 (NP_671733.2).
  
  Sequence:
  MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRAF3IP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRAF3IP2 Antibody - BSA Free

• ACT1DKFZP586G0522
• adapter protein CIKS
• C6orf2
• C6orf4chromosome 6 open reading frame 5
• C6orf5DKFZp586G0522
• C6orf6MGC3581
• CIKSchromosome 6 open reading frame 2
• Connection to IKK and SAPK/JNK
• NFkB-activating protein ACT1
• Nuclear factor NF-kappa-B activator 1
• TRAF3 interacting protein 2
• TRAF3-interacting protein 2

Background

TRAF3IP2 encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Two alternative transcripts encoding different proteins have been identified. A third transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRAF3IP2