JunB/AP-1 Antibody

Images

 
Orthogonal Strategies: Western Blot: JunB/AP-1 Antibody [NBP1-89544] - Analysis in human cell lines MCF-7 and HEK293 using anti-JUNB antibody. Corresponding JUNB RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining in human fallopian tube and skeletal muscle tissues. Corresponding JUNB RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

JunB/AP-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDL
Specificity
Specificity of human JunB/AP-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
JUNB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
JunB/AP-1 Protein (NBP1-89544PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for JunB/AP-1 Antibody

  • activator protein 1
  • AP-1
  • jun B proto-oncogene
  • JunB
  • transcription factor jun-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47757
Species: Hu
Applications: WB, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-89544
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for JunB/AP-1 Antibody (NBP1-89544) (0)

There are no publications for JunB/AP-1 Antibody (NBP1-89544).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JunB/AP-1 Antibody (NBP1-89544) (0)

There are no reviews for JunB/AP-1 Antibody (NBP1-89544). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for JunB/AP-1 Antibody (NBP1-89544) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for JunB/AP-1 Antibody (NBP1-89544)

Discover related pathways, diseases and genes to JunB/AP-1 Antibody (NBP1-89544). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JunB/AP-1 Antibody (NBP1-89544)

Discover more about diseases related to JunB/AP-1 Antibody (NBP1-89544).
 

Pathways for JunB/AP-1 Antibody (NBP1-89544)

View related products by pathway.

PTMs for JunB/AP-1 Antibody (NBP1-89544)

Learn more about PTMs related to JunB/AP-1 Antibody (NBP1-89544).

Blogs on JunB/AP-1

There are no specific blogs for JunB/AP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JunB/AP-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol JUNB
Entrez