We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free

Images

 
Western Blot: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Analysis of extracts of various cell lines, using ANT1/ANT2/ANT3/ANT4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit ...read more
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using Adenine Nucleotide Translocase 1/2/3/4 Rabbit pAb ...read more
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Immunohistochemistry of paraffin-embedded Mouse kidney using Adenine Nucleotide Translocase 1/2/3/4 Rabbit pAb (NBP3-05640) ...read more
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Immunohistochemistry of paraffin-embedded Rat kidney using Adenine Nucleotide Translocase 1/2/3/4 Rabbit pAb (NBP3-05640) at ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2). GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free

  • 2F1
  • AAC1
  • AAC2
  • AAC3
  • AAC4
  • adenine nucleotide translocase 4
  • adenine nucleotide translocator 1 (skeletal muscle)
  • adenine nucleotide translocator 2 (fibroblast)
  • Adenine nucleotide translocator 3
  • Adenine nucleotide translocator 4
  • ADP,ATP carrier protein 1
  • ADP,ATP carrier protein 3
  • ADP,ATP carrier protein 4
  • ADP,ATP carrier protein, fibroblast isoform
  • ADP,ATP carrier protein, heart/skeletal muscle
  • ADP,ATP carrier protein, isoform T2
  • ADP,ATP carrier protein, liver
  • ADP/ATP translocase 1
  • ADP/ATP translocase 2
  • ADP/ATP translocase 3
  • ADP/ATP translocase 4
  • ADP/ATP translocator of liver
  • ANT 1
  • ANT 2
  • ANT 3
  • ANT 4
  • ANT
  • ANT1
  • ANT2
  • ANT3
  • ANT3Y
  • ANT4
  • epididymis secretory sperm binding protein
  • heart/skeletal muscle ATP/ADP translocator
  • MTDPS12
  • MTDPS12A
  • PEO2
  • PEO3
  • PEOA2
  • SFEC35kDa
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6
  • Sperm flagellar energy carrier protein
  • T1
  • T2
  • T3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-20393
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC,  IHC-P, WB
NBP2-15079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP3-32238
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-81038
Species: Bv, Hu, Po, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
202-IL
Species: Hu
Applications: BA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
664-LI
Species: Hu
Applications: BA
NBP3-05640
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for Adenine Nucleotide Translocase 1/2/3/4 Antibody (NBP3-05640) (0)

There are no publications for Adenine Nucleotide Translocase 1/2/3/4 Antibody (NBP3-05640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenine Nucleotide Translocase 1/2/3/4 Antibody (NBP3-05640) (0)

There are no reviews for Adenine Nucleotide Translocase 1/2/3/4 Antibody (NBP3-05640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenine Nucleotide Translocase 1/2/3/4 Antibody (NBP3-05640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenine Nucleotide Translocase 1/2/3/4 Products

Blogs on Adenine Nucleotide Translocase 1/2/3/4

There are no specific blogs for Adenine Nucleotide Translocase 1/2/3/4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A4