TRAF-1 Antibody - BSA Free

Western Blot: TRAF1 Antibody [NBP1-84920] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: TRAF1 Antibody [NBP1-84920] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRAF-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAF-1 Antibody - BSA Free (NBP1-84920) is a polyclonal antibody validated for use in IHC and WB. Anti-TRAF-1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRAF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRAF-1 Protein (NBP1-84920PEP)

Reactivity Notes

Rat (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRAF-1 Antibody - BSA Free

• EBI6
• EBI6MGC:10353
• Epstein-Bar virus-induced protein 6
• Epstein-Barr virus-induced protein 6
• TNF receptor-associated factor 1
• TRAF1
• TRAF-1

Background

The TRAF (TNF receptor-associated factor) family is a group of adapter proteins (TRAFs 1-6) that link a wide variety of cell surface receptors to diverse signaling cascades leading to the activation of NF-kB and mitogen-activated protein kinases (reviewed in Chung et al, 2002). TRAFs are major signal transducers for both the TNF and IL- 1/TLR receptor superfamilies and collectively play important functions in both adaptive and innate immunity. The carboxy-terminal region of TRAFs is required for self-association and interaction with receptor cytoplasmic domains following ligand-induced oligomerization. TRAFs interact with a variety of proteins that regulate receptor-induced cell death or survival, and TRAF-mediated signaling can promote cell survival or interfere with death receptor-induced apoptosis. This antibody recognizes TRAF1; human TRAF1 is a 416 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRAF-1 Antibody (NBP1-84920)(1)

Publication using NBP1-84920

• Verma A, Shet T, Epari S et al. Mediastinal Gray Zone Lymphoma: A Wider Category Than We Think? Int J Surg Pathol 2016-08-01 [PMID: 26957476]

Bioinformatics

• Gene Symbol: TRAF1