We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TOX3 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Analysis in human gallbladder and lymph node tissues using NBP1-86676 antibody. Corresponding TOX3 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Cerebral cortex shows moderate nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Gallbladder shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Stomach shows moderate nuclear positivity in glandular cells.
Simple Western: TOX3 Antibody [NBP1-86676] - Simple Western lane view shows a specific band for TOX3 in 0.2 mg/ml of RT-4 (left) and SHSY5Y (right) lysate. This experiment was performed under reducing conditions using ...read more
Simple Western: TOX3 Antibody [NBP1-86676] - Electropherogram image(s) of corresponding Simple Western lane view. TOX3 antibody was used at 5 ug/ml dilution on RT-4 and SHSY5Y lysates(s).
ChIP-Exo-Seq composite graph for Anti-TOX3 (NBP1-86676) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications Simple Western, IHC, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

TOX3 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOX3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Simple Western 5 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and SHSY5Y, separated by Size, antibody dilution of 5 ug/mL, apparent MW was 95 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
TOX3 Protein (NBP1-86676PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TOX3 Antibody - BSA Free

  • CAG trinucleotide repeat-containing gene F9 protein
  • CAGF9trinucleotide repeat containing 9
  • TNRC9
  • TOX high mobility group box family member 3
  • Trinucleotide repeat-containing gene 9 protein

Background

The protein encoded by the TOX3 gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequence. A minor allele of this gene has been implicated in an elevated risk of breast cancer. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002263-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP3-02962
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-74048
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-87850
Species: Hu
Applications:  IHC-P
AF5415
Applications: ICC, IHC, Simple Western, WB
NBP3-47544
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-87343
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7754-BH/CF
Applications: BA
AF847
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NBP1-90364
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for TOX3 Antibody (NBP1-86676) (0)

There are no publications for TOX3 Antibody (NBP1-86676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOX3 Antibody (NBP1-86676) (0)

There are no reviews for TOX3 Antibody (NBP1-86676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TOX3 Antibody (NBP1-86676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOX3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TOX3