TOX3 Antibody - BSA Free

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Analysis in human gallbladder and lymph node tissues using NBP1-86676 antibody. Corresponding TOX3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Cerebral cortex shows moderate nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Gallbladder shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: TOX3 Antibody [NBP1-86676] - Staining of human Stomach shows moderate nuclear positivity in glandular cells.

Simple Western: TOX3 Antibody [NBP1-86676] - Simple Western lane view shows a specific band for TOX3 in 0.2 mg/ml of RT-4 (left) and SHSY5Y (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: TOX3 Antibody [NBP1-86676] - Electropherogram image(s) of corresponding Simple Western lane view. TOX3 antibody was used at 5 ug/ml dilution on RT-4 and SHSY5Y lysates(s).

• Reactivity: Hu, Mu, Rt
• Applications: Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOX3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
• Predicted Species: Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOX3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Simple Western 5 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and SHSY5Y, separated by Size, antibody dilution of 5 ug/mL, apparent MW was 95 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  TOX3 Protein (NBP1-86676PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TOX3 Antibody - BSA Free

• CAG trinucleotide repeat-containing gene F9 protein
• CAGF9trinucleotide repeat containing 9
• TNRC9
• TOX high mobility group box family member 3
• Trinucleotide repeat-containing gene 9 protein

Background

The protein encoded by the TOX3 gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequence. A minor allele of this gene has been implicated in an elevated risk of breast cancer. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOX3