TOX Antibody

Images

 
Western Blot: TOX Antibody [NBP1-87857] - Analysis in human cell line MOLT-4.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining in human tonsil and liver tissues. Corresponding TOX RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human tonsil shows strong nuclear positivity in germinal center cells and a subset of non-germinal center cells.
Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human pancreas shows nuclear positivity in islets of Langerhans.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TOX Antibody Summary

Immunogen
This antibody was developed against Recombinant TOX Protein corresponding to amino acids: PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN
Specificity
Specificity of human TOX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TOX Recombinant Protein Antigen (NBP1-87857PEP)
Publications
Read Publication using NBP1-87857.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24304814)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOX Antibody

  • KIAA0808
  • KIAA0808TOX1
  • thymocyte selection-associated high mobility group box protein TOX
  • thymocyte selection-associated high mobility group box
  • Thymus high mobility group box protein TOX
  • TOX
  • TOX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-84246
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-83996
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt, Eq
Applications: WB, Simple Western, IHC, IHC-P
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP1-26612
Species: Hu
Applications: IP (-), WB
H00023316-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
7270-IL/CF
Species: Hu

Publications for TOX Antibody (NBP1-87857)(1)

Reviews for TOX Antibody (NBP1-87857) (0)

There are no reviews for TOX Antibody (NBP1-87857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOX Antibody (NBP1-87857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TOX Products

Bioinformatics Tool for TOX Antibody (NBP1-87857)

Discover related pathways, diseases and genes to TOX Antibody (NBP1-87857). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOX Antibody (NBP1-87857)

Discover more about diseases related to TOX Antibody (NBP1-87857).
 

Pathways for TOX Antibody (NBP1-87857)

View related products by pathway.

PTMs for TOX Antibody (NBP1-87857)

Learn more about PTMs related to TOX Antibody (NBP1-87857).
 

Research Areas for TOX Antibody (NBP1-87857)

Find related products by research area.

Blogs on TOX

There are no specific blogs for TOX, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOX