TOM70 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Analysis in human cerebral cortex and pancreas tissues using NBP1-87863 antibody. Corresponding TOMM70 RNA-seq data are ...read more
Western Blot: TOM70 Antibody [NBP1-87863] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TOM70 Antibody [NBP1-87863] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.
Western Blot: TOM70 Antibody [NBP1-87863] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Simple Western: TOM70 Antibody [NBP1-87863] - Detection of TOM70 in purified mitochondrial (lanes 1-3 at 1:100, 1:50 and 1:25 dilutions, respectively) and cytosol (lane 4 at 1:25 dilution) preparations of SVG-A cells. ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TOM70 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOMM70
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 23172368). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Simple Western verified by a customer review.
Control Peptide
TOM70 Protein (NBP1-87863PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87863 in the following applications:

Publications
Read Publications using
NBP1-87863 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOM70 Antibody

  • FLJ90470
  • KIAA0719
  • mitochondrial import receptor subunit TOM70
  • Mitochondrial precursor proteins import receptor
  • TOM70
  • Translocase of outer membrane 70 kDa subunit
  • translocase of outer mitochondrial membrane 70 (yeast) homolog A
  • translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
  • translocase of outer mitochondrial membrane 70 homolog A (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, Simple Western, WB
NBP1-80671
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38289
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-80681
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12426
Species: Bv, Hu, Mu, Po, Pm, Rt
Applications: ELISA, IP, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
AF4859
Species: Hu
Applications: WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
MAB8864
Species: Hu
Applications: IHC
NBP1-84509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Publications for TOM70 Antibody (NBP1-87863)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Review for TOM70 Antibody (NBP1-87863) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-87863:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western TOM70 NBP1-87863
Enlarge
4
reviewed by:
Anonymous -
Simple Western Human 08/03/2016
View

Summary

ApplicationSimple Western
Sample Testedpurified mitochondrial and cytosol preparations of SVG-A cells
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOM70 Antibody (NBP1-87863) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOM70 Products

Bioinformatics Tool for TOM70 Antibody (NBP1-87863)

Discover related pathways, diseases and genes to TOM70 Antibody (NBP1-87863). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOM70 Antibody (NBP1-87863)

Discover more about diseases related to TOM70 Antibody (NBP1-87863).
 

Pathways for TOM70 Antibody (NBP1-87863)

View related products by pathway.

PTMs for TOM70 Antibody (NBP1-87863)

Learn more about PTMs related to TOM70 Antibody (NBP1-87863).
 

Research Areas for TOM70 Antibody (NBP1-87863)

Find related products by research area.

Blogs on TOM70

There are no specific blogs for TOM70, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous -
08/03/2016
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol TOMM70