TOM70 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TOM70 Antibody [NBP1-87863] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Simple Western: TOM70 Antibody [NBP1-87863] - Detection of TOM70 in purified mitochondrial (lanes 1-3 at 1:100, 1:50 and 1:25 dilutions, respectively) and cytosol (lane 4 at 1:25 dilution) preparations of SVG-A cells. Image from verified customer review.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Analysis in human cerebral cortex and pancreas tissues using HPA014589 antibody. Corresponding TOMM70 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOM70 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TOM70 Antibody - BSA Free (NBP1-87863) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-TOM70 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOMM70
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Simple Western Verified by a customer review
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation: Tested in Purified mitochondrial and cytosol preparations of SVG-A cells, separated by Size, antibody dilution of 1:100
• Control Peptide:

  TOM70 Protein (NBP1-87863PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TOM70 Antibody - BSA Free

• FLJ90470
• KIAA0719
• mitochondrial import receptor subunit TOM70
• Mitochondrial precursor proteins import receptor
• TOM70
• Translocase of outer membrane 70 kDa subunit
• translocase of outer mitochondrial membrane 70 (yeast) homolog A
• translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
• translocase of outer mitochondrial membrane 70 homolog A (yeast)

Background

Functional mitochondria require up to 1000 proteins to function properly, with 99% synthesized as precursors in the cytoplasm and transported into the mitochondria with the aid of cytosolic chaperones and mitochondrial translocators (import components). Proteins to be imported are chaperoned to the mitochondria by the cytosolic heat shock protein (cHSP70) and are immediately pursued by Translocators of the Outer Membrane (TOMs), followed by transient interactions of the unfolded proteins with Translocators of the Inner Membrane (TIMs). TOMM70A is ubiquitously expressed in human tissues and localizes in the mitochondria. TOMM70A could play a significant role in the import of nuclear-encoded mitochondrial proteins with internal targeting sites such as ADP/ATP carriers and the uncoupling proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TOM70 Antibody (NBP1-87863)(3)

Publications using NBP1-87863

• Cheema N, Pham L, Nazarian A et al. Effects of 810 nm treatments in acute myofiber contraction of C2C12 myotubes. PLoS ONE 2025-06-27 [PMID: 40577269]
• Andres-Benito P, Gelpi E, Povedano M et al. Gene Expression Profile in Frontal Cortex in Sporadic Frontotemporal Lobar Degeneration-TDP. J Neuropathol Exp Neurol 2018-05-19 [PMID: 29788265] (WB, Human)
• Sotgia F, Whitaker-Menezes D, Martinez-Outschoorn UE et al. Mitochondria fuel breast cancer metabolism: Fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle 2012-12-01 [PMID: 23172368] (IF/IHC, Human)

Review for TOM70 Antibody (NBP1-87863) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer Simple Western Human 08/03/2016

Summary

• Application: Simple Western
• Sample Tested: purified mitochondrial and cytosol preparations of SVG-A cells
• Species: Human

Bioinformatics

• Gene Symbol: TOMM70