TOMM22 Antibody

Images

 
Genetic Strategies: Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: TOMM22 Antibody [NBP1-80671] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining shown in green.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells..
Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human pancreas shows moderate granular cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

TOMM22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOMM22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOMM22 Protein (NBP1-80671PEP)
Publications
Read Publications using
NBP1-80671 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25800673). Mouse reactivity reported in (PMID: 30386187). Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOMM22 Antibody

  • 1C9-2
  • hTom22
  • mitochondrial import receptor subunit TOM22 homolog
  • mitochondrial import receptor Tom22
  • MST065
  • TOM22MSTP065
  • Translocase of outer membrane 22 kDa subunit homolog
  • translocase of outer mitochondrial membrane 22 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-38289
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80681
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBL1-17193
Species: Hu
Applications: WB
MAB8864
Species: Hu
Applications: IHC
NBP2-44318
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-76626
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
H00010431-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-38791
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-76827
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for TOMM22 Antibody (NBP1-80671)(3)

Reviews for TOMM22 Antibody (NBP1-80671) (0)

There are no reviews for TOMM22 Antibody (NBP1-80671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOMM22 Antibody (NBP1-80671). (Showing 1 - 3 of 3 FAQs).

  1. Is the antibody TOMM22 NBP1-80671 an IgG ?
    • Our TOMM22 antibody, NBP1-80671, is a rabbit polyclonal and of the isotype IgG.
  2. Could you tell me the molecular weight of the heavy chain please ?
    • Most IgG molecules have a molecular weight of approximately 150-160kDa. Heavy chains are usually about 50kDa, and light chains approximately 25kDa.
  3. What is the concentration for the lot A57950 of this antibody?
    • Lot number A57950 is at a concentration of 0.3mg/ml.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TOMM22 Products

Bioinformatics Tool for TOMM22 Antibody (NBP1-80671)

Discover related pathways, diseases and genes to TOMM22 Antibody (NBP1-80671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM22 Antibody (NBP1-80671)

Discover more about diseases related to TOMM22 Antibody (NBP1-80671).
 

Pathways for TOMM22 Antibody (NBP1-80671)

View related products by pathway.

Research Areas for TOMM22 Antibody (NBP1-80671)

Find related products by research area.

Blogs on TOMM22

There are no specific blogs for TOMM22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOMM22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM22
Entrez
Uniprot