Genetic Strategies: Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Western Blot: TOMM22 Antibody [NBP1-80671] - Comparative immunoblot analysis of normal wild type versus mdx-4cv liver extracts. Immunoblots with expanded views of labelling with antibodies to the mitochondrial outer ...read more
Immunocytochemistry/ Immunofluorescence: TOMM22 Antibody [NBP1-80671] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining shown in green.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells..
Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human pancreas shows moderate granular cytoplasmic positivity.
Western Blot: TOMM22 Antibody [NBP1-80671] - Comparative immunoblot analysis of normal wild type versus mdx-4cv liver extracts. Shown is a representative silver-stained SDS-PAGE gel & corresponding immunoblots with ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOMM22
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Translocase of outer membrane 22 kDa subunit homolog
translocase of outer mitochondrial membrane 22 homolog (yeast)
Background
TOMM22 is encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TOMM22 Antibody - BSA Free and receive a gift card or discount.