TOMM22 Antibody


Genetic Strategies: Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading more
Western Blot: TOMM22 Antibody [NBP1-80671] - Comparative immunoblot analysis of normal wild type versus mdx-4cv liver extracts. Immunoblots with expanded views of labelling with antibodies to the mitochondrial outer more
Immunocytochemistry/ Immunofluorescence: TOMM22 Antibody [NBP1-80671] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining shown in green.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells..
Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human pancreas shows moderate granular cytoplasmic positivity.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Validated by:

Genetic Strategies


Order Details

TOMM22 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOMM22 Protein (NBP1-80671PEP)
Read Publications using
NBP1-80671 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25800673). Mouse reactivity reported in (PMID: 30386187). Rat (89%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TOMM22 Antibody

  • 1C9-2
  • hTom22
  • mitochondrial import receptor subunit TOM22 homolog
  • mitochondrial import receptor Tom22
  • MST065
  • TOM22MSTP065
  • Translocase of outer membrane 22 kDa subunit homolog
  • translocase of outer mitochondrial membrane 22 homolog (yeast)


TOMM22 is encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Pm, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TOMM22 Antibody (NBP1-80671)(3)

Reviews for TOMM22 Antibody (NBP1-80671) (0)

There are no reviews for TOMM22 Antibody (NBP1-80671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOMM22 Antibody (NBP1-80671). (Showing 1 - 3 of 3 FAQs).

  1. Is the antibody TOMM22 NBP1-80671 an IgG ?
    • Our TOMM22 antibody, NBP1-80671, is a rabbit polyclonal and of the isotype IgG.
  2. Could you tell me the molecular weight of the heavy chain please ?
    • Most IgG molecules have a molecular weight of approximately 150-160kDa. Heavy chains are usually about 50kDa, and light chains approximately 25kDa.
  3. What is the concentration for the lot A57950 of this antibody?
    • Lot number A57950 is at a concentration of 0.3mg/ml.

Secondary Antibodies


Isotype Controls

Additional TOMM22 Products

Bioinformatics Tool for TOMM22 Antibody (NBP1-80671)

Discover related pathways, diseases and genes to TOMM22 Antibody (NBP1-80671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM22 Antibody (NBP1-80671)

Discover more about diseases related to TOMM22 Antibody (NBP1-80671).

Pathways for TOMM22 Antibody (NBP1-80671)

View related products by pathway.

Research Areas for TOMM22 Antibody (NBP1-80671)

Find related products by research area.

Blogs on TOMM22

There are no specific blogs for TOMM22, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TOMM22 Antibody and receive a gift card or discount.


Gene Symbol TOMM22