TOMM20 Antibody (4F3) - Azide and BSA Free

Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.Lane 1: TOMM20 transfected lysate(16.3 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH and TOMM20in C6 glioma. A small glioma labeled with an antibody against Tom20. The brightness and contrast have been increased. Image collected and cropped by CiteAb from the following publication (//www.biomedcentral.com/1756-0500/8/207), licensed under a CC-BY license.

Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3 Analysis of TOMM20 expression in HeLa.

Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3. Analysis of TOMM20 expression in PC-12.

Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3. Analysis of TOMM20 expression in NIH/3T3.

Immunohistochemistry-Paraffin: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.

ELISA: TOMM20 Antibody (4F3) [H00009804-M01] - Detection limit for recombinant GST tagged TOMM20 is approximately 0.1ng/ml as a capture antibody.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH & Tom20 in C6 gliomas. a A section of rat brain stained with hematoxilin & eosin to show a glioma produced by implantation of C6 cells in the right caudate nucleus. In this case, cells also grew in the region of the syringe needle track through the cortex. (b–d). A small glioma labeled by bisbenzamide (b) & with antibodies against Tom20 (c) & GAPDH (d). The brightness & contrast have been increased. e Illustration of a strip perpendicular to the rim of a glioma (labeled with bisbenzamide) & along which intensity profiles were measured. f, g Tom20 & GAPDH fluorescence along such a strip (barely visible without enhancement). The graphs show the raw intensity values given by ImageJ. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26032618), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, Flow, ICC/IF, IHC
• Clone: 4F3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TOMM20 Antibody (4F3) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TOMM20 Antibody (4F3) - Azide and BSA Free (H00009804-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA, Flow and ICC/IF. Anti-TOMM20 Antibody: Cited in 21 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
• Localization: Mitochondrion outer membrane; Multi-pass membrane protein
• Specificity: TOMM20 - translocase of outer mitochondrial membrane 20 homolog (yeast)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TOMM20
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Flow Cytometry
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
• Application Notes: Use in FLOW cytometry reported in scientific literature ( PMID 26779811).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TOMM20 Antibody (4F3) - Azide and BSA Free

• KIAA0016Outer mitochondrial membrane receptor Tom20
• MAS20
• MGC117367
• mitochondrial 20 kDa outer membrane protein
• mitochondrial import receptor subunit TOM20 homolo
• mitochondrial import receptor subunit TOM20 homolog
• MOM19
• outer mitochondrial membrane receptor Tom20
• TOM20
• TOMM20
• translocase of outer mitochondrial membrane 20 hom
• translocase of outer mitochondrial membrane 20 homolog (yeast)
• translocase of outer mitochondrial membrane 20 homolog type II

Background

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TOMM20 Antibody (H00009804-M01)(21)

Publications using H00009804-M01

• So HK, Kim H, Lee J et al. Protein Arginine Methyltransferase 1 Ablation in Motor Neurons Causes Mitochondrial Dysfunction Leading to Age-related Motor Neuron Degeneration with Muscle Loss Research (Washington, D.C.) 2023-06-19 [PMID: 37342629]
• Greiser M, Karbowski M, Kaplan AD et al. Calcium and bicarbonate signaling pathways have pivotal, resonating roles in matching ATP production to demand eLife 2023-06-05 [PMID: 37272417]
  
  Details:
  1:100 IHC-P dilution
• Pandey J, Larson-Casey JL, Patil MH et al. NOX4-TIM23 interaction regulates NOX4 mitochondrial import and metabolic reprogramming The Journal of biological chemistry 2023-04-10 [PMID: 37044213] (WB, Mouse, Human)
• Cheng S, Altmeppen G, So C et al. Mammalian oocytes store mRNAs in a mitochondria-associated membraneless compartment Science (New York, N.Y.) 2022-10-21 [PMID: 36264786]
• Su K, Byeong-Yun A, Thi T et al. PRMT1 suppresses doxorubicin-induced cardiotoxicity by inhibiting endoplasmic reticulum stress. Cell Signal. 2022-07-18 [PMID: 35863589]
• Zhang QQ, Luo L, Liu MX et al. Enriched Environment-Induced Neuroprotection against Cerebral Ischemia-Reperfusion Injury Might Be Mediated via Enhancing Autophagy Flux and Mitophagy Flux Mediators of Inflammation 2022-01-01 [PMID: 35795405]
• Eszter C, Nikolett L, Csaba C et al. Microglia modulate blood flow, neurovascular coupling, and hypoperfusion via purinergic actions. J Exp Med. 2022-02-24 [PMID: 35201268]
• Beatrice P, Vignesh R, Paradesi G et al. Metabolic impairment of non-small cell lung cancers by mitochondrial HSPD1 targeting. J Exp Clin Cancer Res. 2021-08-07 [PMID: 34364401]
• Marie-France D, Mukandila M, Shuya K et al. The CD36 Ligand-Promoted Autophagy Protects Retinal Pigment Epithelial Cells from Oxidative Stress. Oxid Med Cell Longev. 2021-03-28 [PMID: 33854697]
• Soo S, Yunkwon N, Yong P et al. Therapeutic effects of non-saponin fraction with rich polysaccharide from Korean red ginseng on aging and Alzheimer's disease. Free Radic Biol Med. 2021-01-07 [PMID: 33422674]
• Yazdankhah M, Ghosh S, Shang P, et al. BNIP3L-mediated mitophagy is required for mitochondrial remodeling during the differentiation of optic nerve oligodendrocytes Autophagy 2021-01-19 [PMID: 33404293] (WB, Rat)
• Lewis C, Dixit B, Batiuk E et al. Codon optimization is an essential parameter for the efficient allotopic expression of mtDNA genes. Redox Biol. 2020-01-11 [PMID: 31981894]
• Tsitoura E, Vasarmidi E, Bibaki E et al. Accumulation of damaged mitochondria in alveolar macrophages with reduced OXPHOS related gene expression in IPF. Respir Res. 2019-11-27 [PMID: 31775876]
• Lizama BN, PalubinskY AM, Raveendran VA et al. Neuronal Preconditioning Requires the Mitophagic Activity of C-terminus of HSC70-Interacting Protein. J. Neurosci. 2018-06-22 [PMID: 29934347] (WB, ICC/IF)
• Wu M, Liu X, Chi X et al. Mitophagy in Refractory Temporal Lobe Epilepsy Patients with Hippocampal Sclerosis. Cell Mol Neurobiol 2018-03-01 [PMID: 28405902]
• Sidjanin DJ, Park AK, Ronchetti A et al. TBC1D20 mediates autophagy as a key regulator of autophagosome maturation. Autophagy. 2016-08-03 [PMID: 27487390] (WB, Mouse)
• Lood C, Blanco LP, Purmalek MM et al. Neutrophil extracellular traps enriched in oxidized mitochondrial DNA are interferogenic and contribute to lupus-like disease. Nat. Med. 2016-02-01 [PMID: 26779811] (FLOW, ICC/IF, Human)
• Kanfer G, Thibault Courtheoux T, Martin Peterka M et al. Mitotic redistribution of the mitochondrial network by Miro and Cenp-F. Nat Commun 2015-08-11 [PMID: 26259702]
• Grillon E, Farion R, Reuveni M et al. Spatial profiles of markers of glycolysis, mitochondria, and proton pumps in a rat glioma suggest coordinated programming for proliferation. BMC Res Notes 2015-01-01 [PMID: 26032618]
• Grozdanov PN, Stocco DM. Short RNA Molecules with High Binding Affinity to the KH Motif of A-Kinase Anchoring Protein 1 (AKAP1): Implications for the Regulation of Steroidogenesis. Mol Endocrinol. 2012-10-17 [PMID: 23077346]
• Murmu RP, Martin E, Rastetter A et al. Cellular distribution and subcellular localization of spatacsin and spastizin, two proteins involved in hereditary spastic paraplegia. Mol Cell Neurosci. 2011-04-27 [PMID: 21545838]

Bioinformatics

• Gene Symbol: TOMM20
• Entrez:
  • 9804(Human)
• OMIM:
  • 601848(Human)
• Uniprot:
  • AAH66335(Human)