TNPO3 Antibody (0U3Q1)

Western Blot: TNPO3 Antibody (0U3Q1) [NBP3-15908] - Western blot analysis of extracts of various cell lines, using Transportin 3 (TNPO3) Rabbit mAb (NBP3-15908) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry-Paraffin: TNPO3 Antibody (0U3Q1) [NBP3-15908] - Immunohistochemistry of paraffin-embedded human esophageal cancer using Transportin 3 (TNPO3) Rabbit mAb (NBP3-15908) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: TNPO3 Antibody (0U3Q1) [NBP3-15908] - Immunohistochemistry of paraffin-embedded rat kidney using Transportin 3 (TNPO3) Rabbit mAb (NBP3-15908) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: TNPO3 Antibody (0U3Q1) [TNPO3] - Confocal imaging of U-2 OS cells using TNPO3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: TNPO3 Antibody (0U3Q1) [TNPO3] - Confocal imaging of NIH/3T3 cells using TNPO3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: TNPO3 Antibody (0U3Q1) [TNPO3] - Confocal imaging of paraffin-embedded Mouse kidney tissue using TNPO3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 0U3Q1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TNPO3 Antibody (0U3Q1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Transportin 3 (TNPO3) (Q9Y5L0). QVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRPTFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLFR
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TNPO3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 104 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TNPO3 Antibody (0U3Q1)

• imp12
• MTR10A
• transportin 3
• transportin-3

Background

TNPO3 is a nuclear import receptor for serine/arginine-rich (SR) proteins, which are essential precursor-mRNA splicing factors (Kataoka et al., 1999 [PubMed 10366588]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNPO3