TMEM200A Antibody - BSA Free

Immunohistochemistry-Paraffin: TMEM200A Antibody [NBP1-81362] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM200A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM200A Antibody - BSA Free (NBP1-81362) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKM
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM200A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: HIER pH6 retrieval is recommended.
• Control Peptide:

  TMEM200A Protein (NBP1-81362PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM200A Antibody - BSA Free

• found in a patient with schizophrenia
• KIAA1913TTMC
• transmembrane protein 200A
• TTMA
• two transmembrane C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM200A