calmodulin-lysine N-methyltransferase Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: calmodulin-lysine N-methyltransferase Antibody [NBP2-57496] - Staining of human cell line CACO-2 shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

calmodulin-lysine N-methyltransferase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG
Specificity
Specificity of human calmodulin-lysine N-methyltransferase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAMKMT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
calmodulin-lysine N-methyltransferase Recombinant Protein Antigen (NBP2-57496PEP)

Reactivity Notes

Mouse 87%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for calmodulin-lysine N-methyltransferase Antibody

  • C2orf34
  • calmodulin methyltransferase
  • calmodulin-lysine N-methyltransferase
  • CaM KMT
  • Cam
  • chromosome 2 open reading frame 34
  • CLNMTFLJ23451
  • EC 2.1.1.60
  • KMT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-50113
Species: Hu
Applications: WB, ICC/IF, IHC, IP
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
BBA16
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-56348
Species: Hu
Applications: ICC/IF
NBP1-84854
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-98474
Species: Hu
Applications: WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57496
Species: Hu
Applications: ICC/IF

Publications for calmodulin-lysine N-methyltransferase Antibody (NBP2-57496) (0)

There are no publications for calmodulin-lysine N-methyltransferase Antibody (NBP2-57496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for calmodulin-lysine N-methyltransferase Antibody (NBP2-57496) (0)

There are no reviews for calmodulin-lysine N-methyltransferase Antibody (NBP2-57496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for calmodulin-lysine N-methyltransferase Antibody (NBP2-57496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for calmodulin-lysine N-methyltransferase Antibody (NBP2-57496)

Discover related pathways, diseases and genes to calmodulin-lysine N-methyltransferase Antibody (NBP2-57496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on calmodulin-lysine N-methyltransferase

There are no specific blogs for calmodulin-lysine N-methyltransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our calmodulin-lysine N-methyltransferase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMKMT