TMED1 Antibody - BSA Free

Western Blot: TMED1 Antibody [NBP1-62557] - Antibody Titration: 1 ug/ml Human liver.

Immunohistochemistry: TMED1 Antibody [NBP1-62557] - Human Adult liver Observed Staining: Membrane Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.

Western Blot: TMED1 Antibody [NBP1-62557] - 293T cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TMED1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TMED1(transmembrane emp24 protein transport domain containing 1) The peptide sequence was selected from the middle region of TMED1. Peptide sequence FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMED1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TMED1 Antibody - BSA Free

• IL1RL1-Binding Protein
• Il1rl1l
• IL1RL1LG
• IL-1RL1LG
• IL1RL1LGIL1RL1-binding protein
• Interleukin 1 Receptor-Like 1 Ligand
• Interleukin-1 receptor-like 1 ligand
• Ly84l
• MGC1270
• P24g1
• P24gamma1
• Putative T1/ST2 receptor-binding protein
• ST2L
• T1/ST2 receptor binding protein
• TMED1
• Tp24
• transmembrane emp24 domain containing 1
• transmembrane emp24 domain-containing protein 1
• transmembrane emp24 protein transport domain containing 1

Background

TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMED1
• Uniprot:
  • Q13445()