TLE2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TLE2 Antibody [NBP2-13435] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TLE2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TLE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TLE2 Protein (NBP2-13435PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TLE2 Antibody

  • enhancer of split groucho 2
  • ESG
  • ESG2
  • ESG2Enhancer of split groucho-like protein 2
  • FLJ41188
  • GRG2
  • TLE2
  • transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila)
  • transducin-like enhancer of split 2, homolog of Drosophila E(sp1)
  • transducin-like enhancer protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46134
Species: Hu
Applications: WB, Flow, IHC, IF
NBP1-76645
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-15140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30646
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
H00079816-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3125
Species: Hu
Applications: WB, ICC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003131-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-98606
Species: Hu, Am
Applications: WB
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-13435
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TLE2 Antibody (NBP2-13435) (0)

There are no publications for TLE2 Antibody (NBP2-13435).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLE2 Antibody (NBP2-13435) (0)

There are no reviews for TLE2 Antibody (NBP2-13435). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TLE2 Antibody (NBP2-13435) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TLE2 Products

Bioinformatics Tool for TLE2 Antibody (NBP2-13435)

Discover related pathways, diseases and genes to TLE2 Antibody (NBP2-13435). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TLE2 Antibody (NBP2-13435)

Discover more about diseases related to TLE2 Antibody (NBP2-13435).
 

Pathways for TLE2 Antibody (NBP2-13435)

View related products by pathway.

PTMs for TLE2 Antibody (NBP2-13435)

Learn more about PTMs related to TLE2 Antibody (NBP2-13435).
 

Research Areas for TLE2 Antibody (NBP2-13435)

Find related products by research area.

Blogs on TLE2

There are no specific blogs for TLE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TLE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TLE2
Entrez