Recombinant Human Tissue alpha-L-Fucosidase/FUCA1 Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-100 of Human FUCA1 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:EAIYASKPWRVQWEKNITSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK |
| Details of Functionality |
This protein is not active and should not be used for experiments requiring activity. |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
FUCA1 |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Tissue alpha-L-Fucosidase/FUCA1 Protein
Background
FUCA1 - fucosidase, alpha-L- 1, tissue
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Dr, Fi, Gt, Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Tissue alpha-L-Fucosidase/FUCA1 Partial Recombinant Protein (H00002517-Q01) (0)
There are no publications for Tissue alpha-L-Fucosidase/FUCA1 Partial Recombinant Protein (H00002517-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tissue alpha-L-Fucosidase/FUCA1 Partial Recombinant Protein (H00002517-Q01) (0)
There are no reviews for Tissue alpha-L-Fucosidase/FUCA1 Partial Recombinant Protein (H00002517-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Tissue alpha-L-Fucosidase/FUCA1 Partial Recombinant Protein (H00002517-Q01) (0)
Additional Tissue alpha-L-Fucosidase/FUCA1 Products
Blogs on Tissue alpha-L-Fucosidase/FUCA1