TIRAP (TLR2 and TLR4) Inhibitor Peptide Set


Functional (Inhibition): TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-29331] - TLR2/NF-kB/SEAPorter HEK 293 (NBP2-26274) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated ...read more

Product Details

Reactivity Hu, MuSpecies Glossary

Order Details

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set Summary

TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4.

Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Functions as a TIRAP decoy by binding to TIR interacting domains on specific TLR receptors.
The TIRAP inhibitory peptide contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.

The control peptide consists of only the PTD sequence.
Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. TIRAP Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS.
Add 54 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.

Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
- 8g of NaCl
- 0.2g of KCl
- 1.44g of Na2HPO4
- 0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving
TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.


Application Notes
Inhibition of TIRAP binding to TLR2 or TLR4.
Read Publications using
NBP2-29331 in the following applications:

Reactivity Notes

Human, Mouse (the inhibitor peptide sequence is from mouse and also reacts with human; there is only one amino acid difference between the mouse and human sequence).

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Solubilize the peptides prior to use by making 5 mM PBS* stock solutions (please see Preparation of 5 mM Stock Solutions under Preparation Method).
Reconstitution Instructions
Please contact technical support for detailed reconstitution instructions.


The MyD88 Homodimerization inhibitory peptide contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable (Derossi et al, The third helix of the antennapedia homeodomain translocates through biological membranes. J Biol Chem. 269:10444-10450 (1994)].The control peptide consists of only the PTD sequence.

Alternate Names for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

  • adapter protein wyatt
  • Adaptor protein Wyatt
  • FLJ42305
  • Mal
  • MyD88 adapter-like protein
  • TIR domain-containing adapter protein
  • toll/interleukin-1 receptor domain-containing adapter protein
  • toll-interleukin 1 receptor (TIR) domain containing adaptor protein
  • Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
  • Toll-like receptor adaptor protein
  • wyatt


TIRAP/Mal is an adapter protein in the signaling pathways activated by TLR2 and TLR4, and appears to be essential for MyD88-dependent TLR2 and TLR4 signaling pathways. TIRAP is recruited to activated TL2 and TLR4 through interaction with TIR domain of the receptor. This peptide contains a sequence from mouse TIRAP that blocks the function of TIRAP, likely through binding to the receptor and blocking TIR-TIR domain interaction between TIRAP and the receptor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
Species: Hu, Mu, Rt, Ca
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, DB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, B/N, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Supplier Logo

Publications for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331)(4)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: In vitro.

Filter By Application
In vitro
All Applications
Filter By Species
All Species

Reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331) (0)

There are no reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

View specific protocols for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331): Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331). (Showing 1 - 1 of 1 FAQs).

  1. What is the advantage of NBP2-26245 over NBP2-29331? Both of them are TIRAP Inhibitory Peptides but I do not see in the literature provided in the webepage why I would choose one over the other? Or why would I spend more on NBP2-26245?
    • While both of these peptides serve the same function, there are differences in the functional sequence. I would like to direct you to to two attached articles in regards to this. 1. NBP2-26245 (Piao, 2013), sequence is shown in Figure 3G, labelled as mTIRAP 2. NBP2-29331: (Shilling 2002), sequence is described under Reagents and Abs on page 5875. All things aside, we have extensive testing data for NBP2-26245 from in-house testing, whereas we are still in the process of validating NBP2-29331 in-house. We can offer much better support for NBP2-26245 so this is the product I would recommend.

Other Available Formats


Additional TIRAP (TLR2 and TLR4) Products

Bioinformatics Tool for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331)

Discover related pathways, diseases and genes to TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331)

Discover more about diseases related to TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331).

Pathways for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331)

View related products by pathway.

PTMs for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331)

Learn more about PTMs related to TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331).

Research Areas for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331)

Find related products by research area.

Blogs on TIRAP (TLR2 and TLR4)

There are no specific blogs for TIRAP (TLR2 and TLR4), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Review this Product

Be the first to review our TIRAP (TLR2 and TLR4) Inhibitor Peptide Set and receive a gift card or discount.


Gene Symbol TIRAP