Functional (Inhibition): TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-29331] - TLR2/NF-kB/SEAPorter HEK 293 (NBP2-26274) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated ...read more
TIRAP (TLR2 and TLR4) Inhibitor Peptide Set Summary
Description
TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4.
Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Immunogen
Functions as a TIRAP decoy by binding to TIR interacting domains on specific TLR receptors.
Specificity
The TIRAP inhibitory peptide contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.
The control peptide consists of only the PTD sequence.
Preparation Method
Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. TIRAP Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS.
Add 54 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.
Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
- 8g of NaCl
- 0.2g of KCl
- 1.44g of Na2HPO4
- 0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving
Please contact technical support for detailed reconstitution instructions.
Content
TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4.
Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Gene
TIRAP
Applications/Dilutions
Application Notes
Inhibits TIRAP binding to TLR2 or TLR4.
Publications
Read Publications using NBP2-29331 in the following applications:
The inhibitor peptide sequence is from mouse and also reacts with human; there is only one amino acid difference between the mouse and human sequence
Packaging, Storage & Formulations
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Solubilize the peptides prior to use by making 5 mM PBS* stock solutions (please see Preparation of 5 mM Stock Solutions under Preparation Method).
Concentration
LYOPH
Alternate Names for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
adapter protein wyatt
Adaptor protein Wyatt
FLJ42305
MAL
MyD88 adapter-like protein
TIR domain-containing adapter protein
toll/interleukin-1 receptor domain-containing adapter protein
toll-interleukin 1 receptor (TIR) domain containing adaptor protein
Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Toll-like receptor adaptor protein
wyatt
Background
TIRAP/Mal is an adapter protein in the signaling pathways activated by TLR2 and TLR4, and appears to be essential for MyD88-dependent TLR2 and TLR4 signaling pathways. TIRAP is recruited to activated TL2 and TLR4 through interaction with TIR domain of the receptor. This peptide contains a sequence from mouse TIRAP that blocks the function of TIRAP, likely through binding to the receptor and blocking TIR-TIR domain interaction between TIRAP and the receptor.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.
Reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331) (0)
There are no reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
View specific protocols for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331):
FAQs for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331). (Showing 1 - 1 of 1 FAQs).
What is the advantage of NBP2-26245 over NBP2-29331? Both of them are TIRAP Inhibitory Peptides but I do not see in the literature provided in the webepage why I would choose one over the other? Or why would I spend more on NBP2-26245?
While both of these peptides serve the same function, there are differences in the functional sequence. I would like to direct you to to two attached articles in regards to this. 1. NBP2-26245 (Piao, 2013), sequence is shown in Figure 3G, labelled as mTIRAP 2. NBP2-29331: (Shilling 2002), sequence is described under Reagents and Abs on page 5875. All things aside, we have extensive testing data for NBP2-26245 from in-house testing, whereas we are still in the process of validating NBP2-29331 in-house. We can offer much better support for NBP2-26245 so this is the product I would recommend.