TIPIN Antibody

Images

 
Immunohistochemistry: TIPIN Antibody [NBP1-83650] - Immunohistochemical staining of human lymph node shows moderate nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIPIN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIPIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TIPIN Protein (NBP1-83650PEP)
Publications
Read Publications using NBP1-83650.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIPIN Antibody

  • FLJ20516
  • TIMELESS interacting protein
  • TIMELESS-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-89091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-20414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NBP1-83650
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TIPIN Antibody (NBP1-83650)(2)

Reviews for TIPIN Antibody (NBP1-83650) (0)

There are no reviews for TIPIN Antibody (NBP1-83650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TIPIN Antibody (NBP1-83650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIPIN Products

Bioinformatics Tool for TIPIN Antibody (NBP1-83650)

Discover related pathways, diseases and genes to TIPIN Antibody (NBP1-83650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIPIN Antibody (NBP1-83650)

Discover more about diseases related to TIPIN Antibody (NBP1-83650).
 

Pathways for TIPIN Antibody (NBP1-83650)

View related products by pathway.

PTMs for TIPIN Antibody (NBP1-83650)

Learn more about PTMs related to TIPIN Antibody (NBP1-83650).
 

Research Areas for TIPIN Antibody (NBP1-83650)

Find related products by research area.

Blogs on TIPIN

There are no specific blogs for TIPIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIPIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIPIN