TIPIN Antibody


Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650] - Staining of human testis shows high expression.
Immunohistochemistry: TIPIN Antibody [NBP1-83650] - Immunohistochemical staining of human lymph node shows moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650] - Staining in human testis and prostate tissues using anti-TIPIN antibody. Corresponding TIPIN RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TIPIN Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA
Specificity of human TIPIN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TIPIN Protein (NBP1-83650PEP)
Read Publications using NBP1-83650.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TIPIN Antibody

  • FLJ20516
  • TIMELESS interacting protein
  • TIMELESS-interacting protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TIPIN Antibody (NBP1-83650)(2)

Reviews for TIPIN Antibody (NBP1-83650) (0)

There are no reviews for TIPIN Antibody (NBP1-83650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TIPIN Antibody (NBP1-83650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TIPIN Antibody (NBP1-83650)

Discover related pathways, diseases and genes to TIPIN Antibody (NBP1-83650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIPIN Antibody (NBP1-83650)

Discover more about diseases related to TIPIN Antibody (NBP1-83650).

Pathways for TIPIN Antibody (NBP1-83650)

View related products by pathway.

PTMs for TIPIN Antibody (NBP1-83650)

Learn more about PTMs related to TIPIN Antibody (NBP1-83650).

Research Areas for TIPIN Antibody (NBP1-83650)

Find related products by research area.

Blogs on TIPIN

There are no specific blogs for TIPIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TIPIN Antibody and receive a gift card or discount.


Gene Symbol TIPIN