TINAGL1 Antibody

Images

 
Immunohistochemistry-Paraffin: TINAGL1 Antibody [NBP2-13434] Staining of human cerebral cortex shows strong cytoplasmic positivity in endothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TINAGL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DQEPCLVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSS SVMNMHEIYTVLNPGEVLPTAFEASEKWPNLI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TINAGL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TINAGL1 Protein (NBP2-13434PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TINAGL1 Antibody

  • androgen-regulated gene 1
  • ARG1
  • GIS5
  • Glucocorticoid-inducible protein 5
  • LCN7
  • LIECG3
  • lipocalin 7
  • OLRG2
  • OLRG-2
  • Oxidized LDL-responsive gene 2 protein
  • oxidized-LDL responsive gene 2
  • P3ECSL
  • TIN Ag-related protein
  • TINAGL
  • TINAGL1
  • TINAG-like 1
  • TINAGRP
  • TIN-ag-RP
  • tubulointerstitial nephritis antigen-like 1
  • tubulointerstitial nephritis antigen-like
  • Tubulointerstitial nephritis antigen-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46539
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NB200-204
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-13434
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TINAGL1 Antibody (NBP2-13434) (0)

There are no publications for TINAGL1 Antibody (NBP2-13434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TINAGL1 Antibody (NBP2-13434) (0)

There are no reviews for TINAGL1 Antibody (NBP2-13434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TINAGL1 Antibody (NBP2-13434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TINAGL1 Products

Bioinformatics Tool for TINAGL1 Antibody (NBP2-13434)

Discover related pathways, diseases and genes to TINAGL1 Antibody (NBP2-13434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TINAGL1 Antibody (NBP2-13434)

Discover more about diseases related to TINAGL1 Antibody (NBP2-13434).
 

Pathways for TINAGL1 Antibody (NBP2-13434)

View related products by pathway.

PTMs for TINAGL1 Antibody (NBP2-13434)

Learn more about PTMs related to TINAGL1 Antibody (NBP2-13434).

Blogs on TINAGL1

There are no specific blogs for TINAGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TINAGL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TINAGL1
Entrez