TINAGL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TINAGL1 Antibody [NBP2-13434] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: TINAGL1 Antibody [NBP2-13434] - Staining of human placenta shows membranous positivity in endothelial cells.

Immunohistochemistry-Paraffin: TINAGL1 Antibody [NBP2-13434] - Staining of human lymph node shows no positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: TINAGL1 Antibody [NBP2-13434] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.

Staining of human placenta shows strong membranous/ secreted positivity in endothelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TINAGL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TINAGL1 Antibody - BSA Free (NBP2-13434) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DQEPCLVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEASEKWPNLI
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TINAGL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TINAGL1 Protein (NBP2-13434PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TINAGL1 Antibody - BSA Free

• androgen-regulated gene 1
• ARG1
• GIS5
• Glucocorticoid-inducible protein 5
• LCN7
• LIECG3
• lipocalin 7
• OLRG2
• OLRG-2
• Oxidized LDL-responsive gene 2 protein
• oxidized-LDL responsive gene 2
• P3ECSL
• TIN Ag-related protein
• TINAGL
• TINAGL1
• TINAG-like 1
• TINAGRP
• TIN-ag-RP
• tubulointerstitial nephritis antigen-like 1
• tubulointerstitial nephritis antigen-like
• Tubulointerstitial nephritis antigen-related protein

Background

TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expressionin adrenocortical cells. This is a non catalytic peptidase C1family protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TINAGL1