TIMM8A Antibody - Azide and BSA Free

Western Blot: TIMM8A Antibody [H00001678-B01P] - Analysis of TIMM8A expression in HepG2.

Immunocytochemistry/Immunofluorescence: TIMM8A Antibody [H00001678-B01P] - Analysis of purified antibody to TIMM8A on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: TIMM8A Antibody [H00001678-B01P] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A polyclonal antibody. Lane 1: TIMM8A transfected lysate(10.67 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TIMM8A Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: TIMM8A (NP_004076.1, 1 a.a. - 97 a.a.) full-length human protein. MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
• Specificity: TIMM8A - translocase of inner mitochondrial membrane 8 homolog A (yeast),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TIMM8A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM8A Antibody - Azide and BSA Free

• DDP1deafness/dystonia peptide
• DDPMGC12262
• Deafness dystonia protein 1
• DFN1
• mitochondrial import inner membrane translocase subunit Tim8 A
• MTSTIM8
• TIM8A
• translocase of inner mitochondrial membrane 8 (yeast) homolog A
• translocase of inner mitochondrial membrane 8 homolog A (yeast)
• X-linked deafness dystonia protein

Background

This translocase has similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Deafness Dystonia Syndrome (MTS/DFN-1) and it is postulated that MTS/DFN-1 is a mitochondrial disease caused by a defective mitochondrial protein import system. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMM8A
• Entrez:
  • 1678(Human)
• Uniprot:
  • NP_004076.1(Human)