Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD |
Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TIMM13 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-13431 | Applications | Species |
---|---|---|
Kim SH, Choi KY, Park Y Et al. Enhanced Expression of microRNA-1273g-3p Contributes to Alzheimer's Disease Pathogenesis by Regulating the Expression of Mitochondrial Genes Cells Oct 9 2021 [PMID: 34685681] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for TIMM13 Antibody (NBP2-13431)Discover more about diseases related to TIMM13 Antibody (NBP2-13431).
| Pathways for TIMM13 Antibody (NBP2-13431)View related products by pathway.
|
PTMs for TIMM13 Antibody (NBP2-13431)Learn more about PTMs related to TIMM13 Antibody (NBP2-13431).
| Research Areas for TIMM13 Antibody (NBP2-13431)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TIMM13 |