TIMM13 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TIMM13 Antibody [NBP2-13431] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.

Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TIMM13 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIMM13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TIMM13 Protein (NBP2-13431PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TIMM13 Antibody - BSA Free

• mitochondrial import inner membrane translocase subunit Tim13
• mitochondrial import inner membrane translocase subunit Tim13B
• ppv1
• TIM13
• TIM13B
• TIMM13A
• TIMM13B
• translocase of inner mitochondrial membrane 13 (yeast) homolog B
• translocase of inner mitochondrial membrane 13 homolog (yeast)

Background

The TIMM13 gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70 k

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TIMM13 Antibody (NBP2-13431)(2)

Publications using NBP2-13431

• Liao X, Ruan X, Wu X et al. Identification of Timm13 protein translocase of the mitochondrial inner membrane as a potential mediator of liver fibrosis based on bioinformatics and experimental verification Journal of translational medicine 2023-03-10 [PMID: 36899394] (WB, Mouse)
• Kim SH, Choi KY, Park Y Et al. Enhanced Expression of microRNA-1273g-3p Contributes to Alzheimer's Disease Pathogenesis by Regulating the Expression of Mitochondrial Genes Cells 2021-10-09 [PMID: 34685681] (IHC-P, Human)

Bioinformatics

• Gene Symbol: TIMM13