Home » TIMM13 » TIMM13 Antibodies » TIMM13 Antibody

TIMM13 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: TIMM13 Antibody [NBP2-13431] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center & mitochondria. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: TIMM13 Antibody [NBP2-13431] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TIMM13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIMM13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TIMM13 Protein (NBP2-13431PEP)
Publications
Read Publication using
NBP2-13431 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIMM13 Antibody

  • mitochondrial import inner membrane translocase subunit Tim13
  • mitochondrial import inner membrane translocase subunit Tim13B
  • ppv1
  • TIM13
  • TIM13B
  • TIMM13A
  • TIMM13B
  • translocase of inner mitochondrial membrane 13 (yeast) homolog B
  • translocase of inner mitochondrial membrane 13 homolog (yeast)

Background

The TIMM13 gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70 k

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TIMM8A Antibody
(2F11)
H00001678-M01
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11.Lane 1: TIMM8A transfected lysate(11 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Sandwich ELISA: TIMM8A Antibody (2F11) [H00001678-M01] - Detection limit for recombinant GST tagged TIMM8A is approximately 0.3ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Recombinant Human
TIM23 GST (N-Term) Pr ...
H00010431-P01
SDS-Page: Recombinant Human TIM23 Protein [H00010431-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Timeless Antibody
NB100-40853
Western Blot: Timeless Antibody [NB100-40853] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Timeless antibody NB100-40853 used for IP at 6 ug per reaction. Timeless was also immunoprecipitated by rabbit anti-Timeless antibody NB100-40852. For blotting immunoprecipitated Timeless, NB100-40853 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: Timeless Antibody [NB100-40853] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-Timeless used at a dilution of 1:1000 (0.2ug/ml). Detection: DAB
Western Blot: Timeless Antibody [NB100-40853] - Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbitanti-Timeless antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescencewith an exposure time of 75 seconds.
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
TIM-1/KIM-1/HAVCR
Antibody [Unconjugate ...
AF1817
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse TIM‑1/KIM‑1/HAVCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1817) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TIM‑1/KIM‑1/HAVCR at approximately70-80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(36 Publications)
Species: Mu
Applications: WB
Triosephosphate
isomerase Antibody
NBP1-31470
Western Blot: Triosephosphate isomerase Antibody [NBP1-31470] - Various whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Triosephosphate isomerase antibody diluted by 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Triosephosphate isomerase Antibody [NBP1-31470] - Various whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Triosephosphate isomerase antibody diluted by 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Triosephosphate isomerase Antibody [NBP1-31470] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Triosephosphate isomerase stained by Triosephosphate isomerase antibody [C2C3], C-term diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar= 10um.
(1 Review)
(8 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ARHGEF5 Antibody
NB100-2559
Western Blot: ARHGEF5 Antibody [NB100-2559] - (0.1ug/ml) staining of HeLa Lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: ARHGEF5 Antibody [NB100-2559] - (3.75ug/ml) staining of paraffin embedded Human Placenta. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
TIMM9 Antibody
(1D6)
H00026520-M01
Immunohistochemistry-Paraffin: TIMM9 Antibody (1D6) [H00026520-M01] - Analysis of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: TIMM9 Antibody (1D6) [H00026520-M01] - Detection limit for recombinant GST tagged TIMM9 is approximately 0.1ng/ml as a capture antibody.
Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in PC-12.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
TIMM10 Antibody
NBP1-80682
Immunocytochemistry/Immunofluorescence: TIMM10 Antibody [NBP1-80682] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: TIMM10 Antibody [NBP1-80682] - Staining of human heart muscle shows strong granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: TIMM10 Antibody [NBP1-80682] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PRPF6 Antibody
NBP1-92298
Immunocytochemistry/Immunofluorescence: PRPF6 Antibody [NBP1-92298] - Staining of human cell line CACO-2 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PRPF6 Antibody [NBP1-92298] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: PRPF6 Antibody [NBP1-92298] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TIMM23 Antibody
NBP1-80680
Immunocytochemistry/Immunofluorescence: TIMM23 Antibody [NBP1-80680] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
(1 Publication)
Species: Hu
Applications: ICC/IF
TIMM22 Antibody
NBP1-92509
Western Blot: TIMM22 Antibody [NBP1-92509] - Analysis in control (vector only transfected HEK293T lysate) and TIMM22 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TIMM22 Antibody [NBP1-92509] - Staining of human adrenal gland shows strong cytoplasmic in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
TIMM17A Antibody
NBP1-80681
Immunocytochemistry/Immunofluorescence: TIMM17A Antibody [NBP1-80681] - Staining of human cell line SiHa shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TIMM17A Antibody [NBP1-80681] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TIMM17A Antibody [NBP1-80681] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CHCHD4 Antibody
NBP2-99532
Immunohistochemistry-Paraffin: CHCHD4 Antibody [NBP2-99532] - Immunochemical staining CHCHD4 in human kidney with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: CHCHD4 Antibody [NBP2-99532] - Immunochemical staining CHCHD4 in mouse kidney with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: CHCHD4 Antibody [NBP2-99532] - Immunochemical staining CHCHD4 in mouse testis with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Species: Mu
Applications: IHC, IHC-P
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
VDAC1 Antibody
NB100-695
Western Blot: VDAC1 Antibody [NB100-695] - The BNIP3 C-terminus can be phosphorylated. Alkaline extraction of mitochondria-associated proteins, showing alkaline extract of the mitochondrial pellet and the alkaline-resistant mitochondrial pellet from cells expressing each BNIP3 phosphomutant. All blots are representative of at least 3 independent experiments. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0129667), licensed under a CC-BY licence.
Western Blot: VDAC1 Antibody [NB100-695] - The BNIP3 C-terminus can be phosphorylated. Subcellular localization of BNIP3 phosphomutants, showing Western blot of cytosolic and mitochondrial fractions. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0129667), licensed under a CC-BY licence.
Western Blot: VDAC1 Antibody [NB100-695] - Lane 1: rat heart whole cell lysate. Lane 2: none. Load: 35 ug per lane. Primary antibody: VDAC/Porin antibody at 1:1,200 for overnight at 4C. Secondary antibody: IRDye800 (TM) rabbit secondary antibody at 1:10,000 for 45 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: ~32 kDa corresponding to VDAC/Porin (arrowhead).
(6 Publications)
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
TIMM8B Antibody
NBP2-94190
Immunocytochemistry/Immunofluorescence: TIMM8B Antibody [NBP2-94190] - L929 cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Paraffin-embedded human breast cancer using TIMM8B .
Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Mouse heart using TIMM8B antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SLC25A12 Antibody
NBP1-89020
Western Blot: SLC25A12 Antibody [NBP1-89020] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: SLC25A12 Antibody [NBP1-89020] - Analysis using Anti-SLC25A12 antibody NBP1-89020 (A) shows similar pattern to independent antibody NBP2-38249 (B).
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
GFER/ALR Antibody
(829812)
MAB7940
GFER/ALR was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human GFER/ALR Monoclonal Antibody (Catalog # MAB7940) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to cytoplasm of hepatocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and Hep3B human hepatocellular carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human GFER/ALR Monoclonal Antibody (Catalog # MAB7940) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for GFER/ALR at approximately 20-24 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: IHC, WB
Lamin B2 Antibody
(2E2F4) - BSA Free
NBP2-61818
ELISA: Lamin B2 Antibody (2E2F4) [NBP2-61818] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: Lamin B2 Antibody (2E2F4) [NBP2-61818] - Analysis of Hela cells using LMNB2 mouse mAb (green) and negative control (red).
Immunocytochemistry/Immunofluorescence: Lamin B2 Antibody (2E2F4) [NBP2-61818] - Analysis of GC-7901 cells using LMNB2 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 secondary antibody was used.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
SLC25A13 Antibody
NBP1-33380
Western Blot: SLC25A13 Antibody [NBP1-33380] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with SLC25A13 antibody [N3C2], Internal diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SLC25A13 Antibody [NBP1-33380] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: SLC25A13 protein stained by SLC25A13 antibody [N3C2], Internal diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-33380] - Paraffin-embedded mouse kidney. SLC25A13 antibody [N3C2], Internal diluted at 1:500.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TIMM13 Antibody (NBP2-13431)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TIMM13 Antibody (NBP2-13431) (0)

There are no reviews for TIMM13 Antibody (NBP2-13431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TIMM13 Antibody (NBP2-13431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIMM13 Products

Bioinformatics Tool for TIMM13 Antibody (NBP2-13431)

Discover related pathways, diseases and genes to TIMM13 Antibody (NBP2-13431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM13 Antibody (NBP2-13431)

Discover more about diseases related to TIMM13 Antibody (NBP2-13431).
 

Pathways for TIMM13 Antibody (NBP2-13431)

View related products by pathway.

PTMs for TIMM13 Antibody (NBP2-13431)

Learn more about PTMs related to TIMM13 Antibody (NBP2-13431).
 

Research Areas for TIMM13 Antibody (NBP2-13431)

Find related products by research area.

Blogs on TIMM13

There are no specific blogs for TIMM13, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM13 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TIMM13