TIMM13 Antibody

Images

 
Western Blot: TIMM13 Antibody [NBP2-13431] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: TIMM13 Antibody [NBP2-13431] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center & mitochondria.
Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIMM13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKC IGKPGGSLDNSEQKCIAMCMDRYMD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIMM13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TIMM13 Protein (NBP2-13431PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIMM13 Antibody

  • mitochondrial import inner membrane translocase subunit Tim13
  • mitochondrial import inner membrane translocase subunit Tim13B
  • ppv1
  • TIM13
  • TIM13B
  • TIMM13A
  • TIMM13B
  • translocase of inner mitochondrial membrane 13 (yeast) homolog B
  • translocase of inner mitochondrial membrane 13 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00026520-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-80682
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92509
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83537
Species: Hu
Applications: IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
H00026521-M15
Species: Hu
Applications: WB, ELISA
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33380
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TIMM13 Antibody (NBP2-13431) (0)

There are no publications for TIMM13 Antibody (NBP2-13431).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM13 Antibody (NBP2-13431) (0)

There are no reviews for TIMM13 Antibody (NBP2-13431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIMM13 Antibody (NBP2-13431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIMM13 Products

Bioinformatics Tool for TIMM13 Antibody (NBP2-13431)

Discover related pathways, diseases and genes to TIMM13 Antibody (NBP2-13431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM13 Antibody (NBP2-13431)

Discover more about diseases related to TIMM13 Antibody (NBP2-13431).
 

Pathways for TIMM13 Antibody (NBP2-13431)

View related products by pathway.

PTMs for TIMM13 Antibody (NBP2-13431)

Learn more about PTMs related to TIMM13 Antibody (NBP2-13431).
 

Research Areas for TIMM13 Antibody (NBP2-13431)

Find related products by research area.

Blogs on TIMM13

There are no specific blogs for TIMM13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM13