Home » TIMM13 » TIMM13 Antibodies » TIMM13 Antibody

TIMM13 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TIMM13 Antibody [NBP2-13431] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Western Blot: TIMM13 Antibody [NBP2-13431] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: TIMM13 Antibody [NBP2-13431] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TIMM13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKC IGKPGGSLDNSEQKCIAMCMDRYMD
Specificity
Specificity of human TIMM13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIMM13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TIMM13 Protein (NBP2-13431PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIMM13 Antibody

  • mitochondrial import inner membrane translocase subunit Tim13
  • mitochondrial import inner membrane translocase subunit Tim13B
  • ppv1
  • TIM13
  • TIM13B
  • TIMM13A
  • TIMM13B
  • translocase of inner mitochondrial membrane 13 (yeast) homolog B
  • translocase of inner mitochondrial membrane 13 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TIMM8A Antibody
NBP1-84288
Immunocytochemistry/Immunofluorescence: TIMM8A Antibody [NBP1-84288] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TIMM8A Antibody [NBP1-84288] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Timeless Antibody
NB100-40853
Western Blot: Timeless Antibody [NB100-40853] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Timeless antibody NB100-40853 used for IP at 6 ug per reaction. Timeless was also immunoprecipitated by rabbit anti-Timeless antibody NB100-40852. For blotting immunoprecipitated Timeless, NB100-40853 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry: Timeless Antibody [NB100-40853] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-Timeless (Cat. No. NB100-40853) used at a dilution of 1:200 (1ug/ml). Detection: DAB
Western Blot: Timeless Antibody [NB100-40853] - Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Timeless antibody NB100-40853 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, IP
TIM-1/KIM-1/HAVCR
Antibody
NBP1-76701
Western Blot: TIM-1/KIM-1/HAVCR Antibody [NBP1-76701] - Analysis of TIM-1 in 3T3 cell lysate with TIM-1 antibody at 1 ug/mL.
Immunocytochemistry/Immunofluorescence: TIM-1/KIM-1/HAVCR Antibody [NBP1-76701] - in Human Uterus cells. Dilution 20 ug/mL.
Immunohistochemistry-Paraffin: TIM-1/KIM-1/HAVCR Antibody [NBP1-76701] - Human uterus tissue with TIM-1 antibody at 10 ug/ml.
(9 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Triosephosphate
isomerase Antibody
NBP1-31470
Western Blot: Triosephosphate isomerase Antibody [NBP1-31470] - Various whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Triosephosphate isomerase antibody diluted by 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Triosephosphate isomerase Antibody [NBP1-31470] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: Triosephosphate isomerase protein stained by Triosephosphate isomerase antibody [C2C3], C-term diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um
Immunohistochemistry-Paraffin: Triosephosphate isomerase Antibody [NBP1-31470] - Paraffin-embedded SNU-16 xenograft, using antibody at 1:100 dilution.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ARHGEF5 Antibody
NBP1-23000
Western Blot: ARHGEF5 Antibody [NBP1-23000] - Whole cell lysate from HeLa cells. ARHGEF5 was also immunoprecipitated by rabbit anti-ARHGEF5 antibody NBP1-23001.
Immunocytochemistry/Immunofluorescence: ARHGEF5 Antibody [NBP1-23000] - Human colon carcinoma. Antibody used at a dilution of 1:200 (1ug/ml).
Immunohistochemistry: ARHGEF5 Antibody [NBP1-23000] - FFPE section of human colon carcinoma. Antibody used at a dilution of 1:250. Detection: DAB staining using Immunohistochemistry Accessory Kit.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
TIMM9 Antibody
(1D6)
H00026520-M01
Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in NIH/3T3.
Immunohistochemistry-Paraffin: TIMM9 Antibody (1D6) [H00026520-M01] - Analysis of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: TIMM9 Antibody (1D6) [H00026520-M01] - TIMM9 monoclonal antibody (M01), clone 1D6. Analysis of TIMM9 expression in PC-12.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
TIMM10 Antibody
NBP1-80682
Immunocytochemistry/Immunofluorescence: TIMM10 Antibody [NBP1-80682] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: TIMM10 Antibody [NBP1-80682] - Staining of human testis shows strong granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: TIMM10 Antibody [NBP1-80682] - Staining of human heart muscle shows strong granular cytoplasmic positivity.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRPF6 Antibody
NBP1-92298
Western Blot: PRPF6 Antibody [NBP1-92298] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: PRPF6 Antibody [NBP1-92298] - Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: PRPF6 Antibody [NBP1-92298] - Staining in human fallopian tube and pancreas tissues using anti-PRPF6 antibody. Corresponding PRPF6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TIMM23 Antibody
NBP1-80680
Immunocytochemistry/Immunofluorescence: TIMM23 Antibody [NBP1-80680] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: TIMM23 Antibody [NBP1-80680] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TIMM22 Antibody
NBP1-92509
Western Blot: TIMM22 Antibody [NBP1-92509] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TIMM22 Antibody [NBP1-92509] - Staining of human adrenal gland shows strong cytoplasmic in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
TIMM17A Antibody
NBP1-80681
Western Blot: TIMM17A Antibody [NBP1-80681] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: TIMM17A Antibody [NBP1-80681] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: TIMM17A Antibody [NBP1-80681] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CHCHD4 Antibody
(6C9)
H00131474-M01-100ug
Western Blot: CHCHD4 Antibody (6C9) [H00131474-M01-100ug] - CHCHD4 monoclonal antibody (M01), clone 6C9. Western Blot analysis of CHCHD4 expression in HeLa.
Western Blot: CHCHD4 Antibody (6C9) [H00131474-M01-100ug] - Detection against immunogen (42.4 kDa).
ELISA: CHCHD4 Antibody (6C9) [H00131474-M01-100ug] - Detection limit for recombinant GST tagged CHCHD4 is 0.03 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(39 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
VDAC1 Antibody
NB100-695
Western Blot: VDAC1 Antibody [NB100-695] - Lane 1: rat heart whole cell lysate. Lane 2: none. Load: 35 ug per lane. Primary antibody: VDAC/Porin antibody at 1:1,200 for overnight at 4C. Secondary antibody: IRDye800 (TM) rabbit secondary antibody at 1:10,000 for 45 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: ~32 kDa corresponding to VDAC/Porin (arrowhead).
(4 Publications)
Species: Hu, Av, Bv, Fi, Ma, Re
Applications: WB, ELISA, IHC
TIMM8B Antibody
NBP1-84287
Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP1-84287] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.
Species: Hu
Applications: IHC, IHC-P
SLC25A12 Antibody
NBP2-38249
Western Blot: SLC25A12 Antibody [NBP2-38249] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP2-38249] - Staining in human heart muscle and liver tissues using anti-SLC25A12 antibody. Corresponding SLC25A12 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP2-38249] - Staining of human heart muscle shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
GFER/ALR Antibody
(829812)
MAB7940
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and Hep3B human hepatocellular carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human GFER/ALR Monoclonal Antibody (Catalog # MAB7940) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for GFER/ALR at approximately 20-24 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
GFER/ALR was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human GFER/ALR Monoclonal Antibody (Catalog # MAB7940) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to cytoplasm of hepatocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC
Lamin B2 Antibody
(144)
NBP2-43834
Western Blot: Lamin B2 Antibody (144) [NBP2-43834] - Non-transfected (-) and transfected (+) HepG2 whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Lamin B2 antibody [144]. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Lamin B2 Antibody (144) [NBP2-43834] - Analysis of HeLa cells were fixed in 2% paraformaldehyde for 30 min. Red: LMNB2 protein stained by Lamin B2 antibody [144] diluted at 1:1000. Green: alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining. [Images captured by Olympus FV1000 Confocal Laser Scanning Microscope]
Immunohistochemistry-Paraffin: Lamin B2 Antibody (144) [NBP2-43834] - Analysis of Cal27 xenograft. Lamin B2 antibody [144] dilution: 1:200.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
SLC25A13 Antibody
NBP1-33380
Western Blot: SLC25A13 Antibody [NBP1-33380] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with SLC25A13 antibody [N3C2], Internal diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SLC25A13 Antibody [NBP1-33380] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: SLC25A13 protein stained by SLC25A13 antibody [N3C2], Internal diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-33380] - Paraffin-embedded mouse kidney. SLC25A13 antibody [N3C2], Internal diluted at 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TIMM13 Antibody
NBP2-13431
TIMM13 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TIMM13 Antibody (NBP2-13431) (0)

There are no publications for TIMM13 Antibody (NBP2-13431).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM13 Antibody (NBP2-13431) (0)

There are no reviews for TIMM13 Antibody (NBP2-13431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIMM13 Antibody (NBP2-13431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TIMM13 Antibody (NBP2-13431)

Discover related pathways, diseases and genes to TIMM13 Antibody (NBP2-13431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM13 Antibody (NBP2-13431)

Discover more about diseases related to TIMM13 Antibody (NBP2-13431).
 

Pathways for TIMM13 Antibody (NBP2-13431)

View related products by pathway.

PTMs for TIMM13 Antibody (NBP2-13431)

Learn more about PTMs related to TIMM13 Antibody (NBP2-13431).
 

Research Areas for TIMM13 Antibody (NBP2-13431)

Find related products by research area.

Blogs on TIMM13

There are no specific blogs for TIMM13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM13 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TIMM13