TIM-4 Recombinant Protein Antigen

Images

 
There are currently no images for TIM-4 Protein (NBP1-87569PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TIM-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIMD4.

Source: E. coli

Amino Acid Sequence: VFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TIMD4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87569.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIM-4 Recombinant Protein Antigen

  • FLJ27515
  • Smuckler
  • T-cell immunoglobulin and mucin domain containing 4
  • T-cell immunoglobulin and mucin domain-containing protein 4
  • T-cell membrane protein 4
  • TIM4
  • TIM-4
  • TIMD4
  • TIMD-4

Background

The T cell immunoglobulin and mucin domain containing protein (TIM) family encodes cell surface receptors that are involved in the regulation of T helper (Th) -1 and -2 cell-mediated immunity. Studies have shown that TIM 4, which is preferentially expressed on macrophages and dendritic cells, is the natural ligand of TIM 1, and that this binding leads to T-cell expansion and cytokine production. Unlike other members of the TIM family, TIM 4 lacks a putative tyrosine phosphorylation signal sequence in its intracellular domain (Kuchroo et al, 2003). The TIM 4 gene maps to a locus associated with predisposition to asthma in both mice and humans and with its connection to TIM 1-triggered Th2 responsiveness, may be considered as a candidate disease/predisposition gene for asthma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-40853
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-2559
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF2365
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, KO, WB
NBP1-71693
Species: Hu
Applications: ICC/IF, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
485-MI
Species: Mu
Applications: BA
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
1257-FC
Species: Hu
Applications: Bind
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-87569PEP
Species: Hu
Applications: AC

Publications for TIM-4 Protein (NBP1-87569PEP) (0)

There are no publications for TIM-4 Protein (NBP1-87569PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIM-4 Protein (NBP1-87569PEP) (0)

There are no reviews for TIM-4 Protein (NBP1-87569PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TIM-4 Protein (NBP1-87569PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIM-4 Products

Research Areas for TIM-4 Protein (NBP1-87569PEP)

Find related products by research area.

Blogs on TIM-4

There are no specific blogs for TIM-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TIM-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMD4