Tight Junction Protein 2 Antibody

Images

 
Western Blot: Tight Junction Protein 2 Antibody [NBP1-86850] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and cell junctions.
Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tight Junction Protein 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
Marker
Intercellular Junctions Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TJP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tight Junction Protein 2 Protein (NBP1-86850PEP)
Reviewed Applications
Read 3 Reviews rated 5
using
NBP1-86850 in the following applications:

Publications
Read Publications using
NBP1-86850 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28420508).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tight Junction Protein 2 Antibody

  • C9DUPq21.11
  • DFNA51
  • DUP9q21.11
  • MGC26306
  • tight junction protein 2 (zona occludens 2)
  • Tight junction protein 2
  • TJP2
  • X104
  • X104tight junction protein ZO-2
  • ZO2
  • ZO-2
  • ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2)
  • Zona occludens protein 2
  • Zonula occludens protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB120-15106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-86850
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Tight Junction Protein 2 Antibody (NBP1-86850)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Tight Junction Protein 2 Antibody (NBP1-86850) (3) 53

Average Rating: 5
(Based on 3 reviews)
We have 3 reviews tested in 2 species: Mouse, Primary mouse lung endothelial cells and Mouse.
We have 3 reviews tested in 3 application: ICC, WB, ICC/IF.

Reviews using NBP1-86850:
Filter by Applications
ICC
(1)
WB
(1)
ICC/IF
(1)
All Applications
Filter by Species
Mouse
(2)
Primary mouse lung endothelial cells and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Tight Junction Protein 2 NBP1-86850
Enlarge
reviewed by:
Jim Hsiao
ICC Mouse 05/17/2017
View

Summary

ApplicationImmunocytochemistry
Sample TestedFrozen Tissue,Mouse lung frozen section
SpeciesMouse

Comments

CommentsLung frozen section was blocked and stained with TJP-2 @ 1:100 dilution for a hour. A secondary Alexa 555-conjugated goat anti-rabbit antibody was used for labeling. Section was aso co-stained with CD31 antibody in conjunction with an Alexa 488-conjugated antibody. Nuclei was revealed by DAPU staining.
Western Blot Tight Junction Protein 2 NBP1-86850
Enlarge
reviewed by:
Jim Hsiao
WB Mouse 05/11/2017
View

Summary

ApplicationWestern Blot
Sample TestedPrimary mouse lung endothelial cells
SpeciesMouse

Comments

CommentsThe antibody was diluted in PBST contained 5% milk at 1:1000. The secondary antibody was diluted at 1:5000.
Immunocytochemistry/Immunofluorescence Tight Junction Protein 2 NBP1-86850
Enlarge
reviewed by:
Jim Hsiao
ICC/IF Primary mouse lung endothelial cells and Mouse 10/13/2016
View

Summary

ApplicationImmunocytochemistry/Immunofluorescence
Sample TestedPrimary mouse lung endothelial cells
SpeciesPrimary mouse lung endothelial cells and Mouse
LotA35234

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tight Junction Protein 2 Antibody (NBP1-86850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tight Junction Protein 2 Products

Bioinformatics Tool for Tight Junction Protein 2 Antibody (NBP1-86850)

Discover related pathways, diseases and genes to Tight Junction Protein 2 Antibody (NBP1-86850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tight Junction Protein 2 Antibody (NBP1-86850)

Discover more about diseases related to Tight Junction Protein 2 Antibody (NBP1-86850).
 

Pathways for Tight Junction Protein 2 Antibody (NBP1-86850)

View related products by pathway.

PTMs for Tight Junction Protein 2 Antibody (NBP1-86850)

Learn more about PTMs related to Tight Junction Protein 2 Antibody (NBP1-86850).

Blogs on Tight Junction Protein 2.

Zonula Occludens (ZO) the Junction Scaffolding Proteins
The Zonula Occludens (ZO) proteins 1,2 and 3, also known as tight junction proteins, are peripheral proteins localizing at junctional sites(1). ZO proteins are known to be scaffolding proteins recruiting various types of proteins to the cytoplasmic...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
3
4
0
3
0
2
0
1
0

Jim Hsiao
05/17/2017
Application: ICC
Species: Mouse

Jim Hsiao
05/11/2017
Application: WB
Species: Mouse

Jim Hsiao
10/13/2016
Application: ICC/IF
Species: Primary mouse lung endothelial cells and Mouse

Bioinformatics

Gene Symbol TJP2