Thyrotropin Releasing Hormone Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRH (NP_009048.1). EEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TRH |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 1:50-1:200
- Western Blot 1:500-1:2000
|
Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free
Background
Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for Thyrotropin Releasing Hormone Antibody (NBP2-94348) (0)
There are no publications for Thyrotropin Releasing Hormone Antibody (NBP2-94348).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Thyrotropin Releasing Hormone Antibody (NBP2-94348) (0)
There are no reviews for Thyrotropin Releasing Hormone Antibody (NBP2-94348).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Thyrotropin Releasing Hormone Antibody (NBP2-94348) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Thyrotropin Releasing Hormone Products
Bioinformatics Tool for Thyrotropin Releasing Hormone Antibody (NBP2-94348)
Discover related pathways, diseases and genes to Thyrotropin Releasing Hormone Antibody (NBP2-94348). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Thyrotropin Releasing Hormone Antibody (NBP2-94348)
Discover more about diseases related to Thyrotropin Releasing Hormone Antibody (NBP2-94348).
| | Pathways for Thyrotropin Releasing Hormone Antibody (NBP2-94348)
View related products by pathway.
|
PTMs for Thyrotropin Releasing Hormone Antibody (NBP2-94348)
Learn more about PTMs related to Thyrotropin Releasing Hormone Antibody (NBP2-94348).
| | Research Areas for Thyrotropin Releasing Hormone Antibody (NBP2-94348)
Find related products by research area.
|
Blogs on Thyrotropin Releasing Hormone