Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Western Blot: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of extracts of various cell lines, using Thyrotropin Releasing Hormone at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348] - Immunofluorescence analysis of U2OS cells using Thyrotropin Releasing Hormone Rabbit pAb (A14472) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348] - Immunofluorescence analysis of H9C2 cells using Thyrotropin Releasing Hormone Rabbit pAb (A14472) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of L929 cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Thyrotropin Releasing Hormone Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Thyrotropin Releasing Hormone Antibody - Azide and BSA Free (NBP2-94348) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 143-242 of human Thyrotropin Releasing Hormone (NP_009048.1). WLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

• MGC125964
• MGC125965
• prothyroliberin
• thyrotropin-releasing hormone

Background

Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TRH