Thyroid receptor-interacting protein 13 Antibody

Images

 
Western Blot: Thyroid receptor-interacting protein 13 Antibody [NBP1-90335] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: ...read more
Immunocytochemistry/ Immunofluorescence: Thyroid receptor-interacting protein 13 Antibody [NBP1-90335] - Immunofluorescent staining of human cell line SiHa shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 13 Antibody [NBP1-90335] - Staining of human testis shows moderate positivity in seminiferous ducts.
Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 13 Antibody [NBP1-90335] - Staining of human lung shows distinct membranous positivity in alveolar cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Thyroid receptor-interacting protein 13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLVYDVEVKSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIP13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Thyroid receptor-interacting protein 13 Protein (NBP1-90335PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Thyroid receptor-interacting protein 13 Antibody

  • 16E1BP
  • 16E1-BP
  • HPV16 E1 protein binding protein
  • Human papillomavirus type 16 E1 protein-binding protein
  • thyroid hormone receptor interactor 13HPV16 E1 protein-binding protein
  • thyroid receptor interacting protein 13
  • thyroid receptor-interacting protein 13
  • TR-interacting protein 13
  • TRIP-13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30377
Species: Hu
Applications: WB, IHC, IHC-P
NB100-181
Species: Hu, Mu
Applications: WB, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00164045-R01
Species: Hu
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-85822
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-58172
Species: Hu
Applications: WB
NBP1-85401
Species: Hu
Applications: IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82724
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335) (0)

There are no publications for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335) (0)

There are no reviews for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thyroid receptor-interacting protein 13 Products

Bioinformatics Tool for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335)

Discover related pathways, diseases and genes to Thyroid receptor-interacting protein 13 Antibody (NBP1-90335). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335)

Discover more about diseases related to Thyroid receptor-interacting protein 13 Antibody (NBP1-90335).
 

Pathways for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335)

View related products by pathway.

Research Areas for Thyroid receptor-interacting protein 13 Antibody (NBP1-90335)

Find related products by research area.

Blogs on Thyroid receptor-interacting protein 13

There are no specific blogs for Thyroid receptor-interacting protein 13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thyroid receptor-interacting protein 13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIP13