SPO11 Antibody

Images

 
Western Blot: SPO11 Antibody [NBP1-58172] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: SPO11 Antibody [NBP1-58172] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPO11 Antibody Summary

Immunogen
Synthetic peptides corresponding to SPO11(SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SPO11. Peptide sequence KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNII The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (93%), Rabbit (93%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPO11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPO11 and was validated on Western blot.
Publications
Read Publication using
NBP1-58172 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23525040).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPO11 Antibody

  • Cancer/testis antigen 35
  • CT35MGC39953
  • meiotic recombination protein SPO11
  • SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)
  • SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae)
  • SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like

Background

Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family. Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP2-02667
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NB100-147
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, In vitro, KD
NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-87144
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP
38750002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-94754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, PAGE, KO
NBP2-03688
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58116
Species: Hu
Applications: WB, ICC/IF, PLA, KD
NBP1-80844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-229
Species: Mu, Rt, Ch, Ma, Pm, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for SPO11 Antibody (NBP1-58172)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SPO11 Antibody (NBP1-58172) (0)

There are no reviews for SPO11 Antibody (NBP1-58172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPO11 Antibody (NBP1-58172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPO11 Products

Bioinformatics Tool for SPO11 Antibody (NBP1-58172)

Discover related pathways, diseases and genes to SPO11 Antibody (NBP1-58172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPO11 Antibody (NBP1-58172)

Discover more about diseases related to SPO11 Antibody (NBP1-58172).
 

Pathways for SPO11 Antibody (NBP1-58172)

View related products by pathway.

PTMs for SPO11 Antibody (NBP1-58172)

Learn more about PTMs related to SPO11 Antibody (NBP1-58172).
 

Research Areas for SPO11 Antibody (NBP1-58172)

Find related products by research area.

Blogs on SPO11

There are no specific blogs for SPO11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPO11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPO11
Uniprot