Home » SPO11 » SPO11 Antibodies » SPO11 Antibody

SPO11 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SPO11 Antibody [NBP1-58172] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: SPO11 Antibody [NBP1-58172] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: SPO11 Antibody [NBP1-58172] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SPO11 Antibody Summary

Immunogen
Synthetic peptides corresponding to SPO11(SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SPO11. Peptide sequence KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPO11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SPO11 and was validated on Western blot.
Publications
Read Publication using
NBP1-58172 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23525040).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPO11 Antibody

  • Cancer/testis antigen 35
  • CT35MGC39953
  • meiotic recombination protein SPO11
  • SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)
  • SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae)
  • SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like

Background

Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family. Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMC1 Antibody
(1D12/4)
NB100-181
Western Blot: DMC1 Antibody (1D12/4) [NB100-181] - Analysis of DMC1 on human testis using NB100-181.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: IP, WB
HID1 Antibody
(OTI2F4)
NBP2-02667
Western Blot: HID1 Antibody (OTI2F4) [NBP2-02667] - Analysis of extracts (10ug) from 10 Human tissue by using anti-C17orf28 monoclonal antibody at 1:500 (1: Testis; 2: Omentum; 3: Uterus; 4: Breast; 5: Brain; 6: Liver; 7: Ovary; 8: Thyroid gland; 9: colon;10: spleen).
Flow Cytometry: HID1 Antibody (2F4) [NBP2-02667] - Analysis of Jurkat cells, using anti-C17orf28 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: HID1 Antibody (2F4) [NBP2-02667] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-C17orf28 antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
(5 Reviews)
(59 Publications)
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Rad50 Antibody
(13B3)
NB100-147
Immunohistochemistry-Paraffin: Rad50 Antibody (13B3) [NB100-147] - Human lung cancer. Rad50 stained by Rad50 antibody [13B3] diluted at 1:100.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: Rad50 Antibody (13B3) [NB100-147] - Human lung cancer. Rad50 stained by Rad50 antibody [13B3] diluted at 1:100.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Western Blot: Rad50 Antibody (13B3) [NB100-147] - Analysis of RAD50 in 293T cell lysate using anti-RAD50 antibody.Image submitted by a verified customer review.
(1 Review)
(78 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
ATM Antibody
NB100-104
Flow Cytometry: ATM Antibody [NB100-104] - Analysis of PE conjugate of ATM Antibody [NB100-104PE]. An intracellular stain was performed on HeLa cells with ATM antibody [NB100-104PE] (blue) and a matched isotype control [NBP2-24893PE] (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone with ATM Antibody [NB100-104].
Flow Cytometry: ATM Antibody [NB100-104] - An intracellular stain was performed on HepG2 cells with PE-conjugated ATM antibody [NB100-104PE] (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(2 Reviews)
(96 Publications)
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: CyTOF-ready, Flow, WB
REC8 Antibody
NBP1-87145
Immunocytochemistry/Immunofluorescence: REC8 Antibody [NBP1-87145] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CtIP Antibody
NB100-79810
Western Blot: CtIP Antibody [NB100-79810] - Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbitanti-CtIP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with anexposure time of 3 minutes.
Immunoprecipitation: CtIP Antibody [NB100-79810] - Detection of human CtIP by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-CtIP antibody NB100-79810 used for IP at 3 ug per reaction. CtIP was also immunoprecipitated by rabbit anti-CtIP antibody NB100-79809. For blotting immunoprecipitated CtIP, NB100-79810 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
MSH5 Antibody
NBP1-20946
Immunohistochemistry-Paraffin: MSH5 Antibody [NBP1-20946] - Staining of Human Thymus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: MSH5 Antibody [NBP1-20946] - Staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
MLH1 Antibody
(SP08-04)
NBP2-67381
Flow Cytometry: MLH1 Antibody (SP08-04) [NBP2-67381] - Analysis of Hela cells with MLH1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: MLH1 Antibody (SP08-04) [NBP2-67381] - Staining MLH1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MLH1 Antibody (SP08-04) [NBP2-67381] - Immunohistochemical analysis of paraffin-embedded human tonsil tissue using anti-MLH1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (ET1604-41, 1/200) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Recombinant Human
MSH4 GST (N-Term) Pro ...
H00004438-Q01
SDS-Page: Recombinant Human MSH4 Protein [H00004438-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NLRP2/NALP2
Antibody
NB100-56155
Immunohistochemistry-Paraffin: NLRP2/NALP2 Antibody [NB100-56155] - NLRP2 was detected in immersion fixed paraffin-embedded sections of human placenta using Rabbit Anti-Human NLRP2 polyclonal Antibody (Catalog # NB100-56155) at 1:500 for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in horionic villi.
Western Blot: NLRP2/NALP2 Antibody [NB100-56155] - Analysis of NLRP2/NALP2 using antibody at 1:2000. HEK293T: mock transfected cells, HEK293T-NALP2:NALP2 transiently transfected cells; THP-1: untreated cells; THP1-LPS: cells treated with 1 ug/ml LPS for4h. MCF-7: untreated cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP, WB
Nbs1 Antibody
NB100-143
Knockout Validated: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Nbs1 Antibody [NB100-143] - Western Blot with Nbs1 Antibody [NB100-143]. KSHV LANA recruits MRN (Mre11-Rad50-NBS1) complex. Co-immunoprecipitation of endogenous LANA and MRN proteins in BC3 cells. Cells were lysed using TBS-T buffer and the cell lysate was incubated with benzonase. After centrifugation, supernatant was incubated overnight with anti-LANA or IgG-control beads. The precipitated complexes were analyzed for the presence of endogenous Rad50, Mre11 and NBS1 by SDS-PAGE and immunoblotting. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.ppat.1006335), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Nbs1 Antibody [NB100-143] - Staining of HeLa cells using Nbs1 Antibody [NB100-143].
(8 Reviews)
(189 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KO, PAGE, WB
SAE2 Antibody
(OTI4A3)
NBP2-03688
Western Blot: SAE2 Antibody (4A3) [NBP2-03688] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SAE2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SAE2.
Immunohistochemistry-Paraffin: SAE2 Antibody (4A3) [NBP2-03688] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-SAE2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: SAE2 Antibody (4A3) [NBP2-03688] - Staining of paraffin-embedded Human endometrium tissue using anti-SAE2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RAD52 Antibody
NBP2-58116
Western Blot: RAD52 Antibody [NBP2-58116] - HCC1937 human breast cancer cells untreated (1) and treated with a PARP inhibitor for 96 h (2). Two RAD52 bands can be appreciated at around 55 kDa. Ponceau red staining is used as total protein loading control (below). Primary antibody dilution 1:500 (overnight, 4C, rotation). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: RAD52 Antibody [NBP2-58116] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, KD, WB
RED1 Antibody
H00000104-B01P
Western Blot: RED1 Antibody [H00000104-B01P] - Expression in HepG2.
Immunocytochemistry/Immunofluorescence: RED1 Antibody [H00000104-B01P] - Analysis of purified antibody to ADARB1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: RED1 Antibody [H00000104-B01P] - Analysis of ADARB1 expression in transfected 293T cell line by ADARB1 polyclonal antibody. Lane 1: ADARB1 transfected lysate(81.51 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, WB
WDR61 Antibody
NBP1-80844
Immunocytochemistry/Immunofluorescence: WDR61 Antibody [NBP1-80844] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human cerebral cortex, colon, kidney and testis using Anti-WDR61 antibody NBP1-80844 (A) shows similar protein distribution across tissues to independent antibody NBP1-80845 (B).
Western Blot: WDR61 Antibody [NBP1-80844] - Analysis using Anti-WDR61 antibody NBP1-80844 (A) shows similar pattern to independent antibody NBP1-80845 (B).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SCP1 Antibody -
BSA Free
NB300-229
Immunocytochemistry/Immunofluorescence: SCP1 Antibody [NB300-229] - Mouse spermatozoa. Green: SCP1 staining. ICC/IF image submitted by a verified customer review.
Western Blot: SCP1 Antibody [NB300-229] - Meiotic chromosome spreads from wild type and Fance mutant (MT) primary spermatocytes isolated from the testes at 20 dpp. Each chromatin spread was staged by analyzing SYCP3 (red) and SYCP1 (green), which are axial element and central region components of the synaptonemal complex respectively. Most of the Fance mutant spermatocytes displayed normal synapsis (middle panels); however a sub-set displayed synapsis abnormalities including an association between non-homologous chromosome ends (arrow head) and abnormal SYCP3 structures (arrows). Dearth and Delayed Maturation of Testicular Germ Cells in Fanconi Anemia E Mutant Male Mice. PLoS One (2016)
Immunocytochemistry/Immunofluorescence: SCP1 Antibody [NB300-229] - Mouse spermatocyte. Red: scp1 colocalized with scp3 (green). ICC/IF image submitted by a verified customer review.
(3 Reviews)
(49 Publications)
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

Publications for SPO11 Antibody (NBP1-58172)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SPO11 Antibody (NBP1-58172) (0)

There are no reviews for SPO11 Antibody (NBP1-58172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPO11 Antibody (NBP1-58172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPO11 Products

Bioinformatics Tool for SPO11 Antibody (NBP1-58172)

Discover related pathways, diseases and genes to SPO11 Antibody (NBP1-58172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPO11 Antibody (NBP1-58172)

Discover more about diseases related to SPO11 Antibody (NBP1-58172).
 

Pathways for SPO11 Antibody (NBP1-58172)

View related products by pathway.

PTMs for SPO11 Antibody (NBP1-58172)

Learn more about PTMs related to SPO11 Antibody (NBP1-58172).
 

Research Areas for SPO11 Antibody (NBP1-58172)

Find related products by research area.

Blogs on SPO11

There are no specific blogs for SPO11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPO11 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SPO11
Uniprot