HORMAD2 Antibody

Images

 
Western Blot: HORMAD2 Antibody [NBP1-82724] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells and nuclear staining in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HORMAD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HORMAD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HORMAD2 Protein (NBP1-82724PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HORMAD2 Antibody

  • HORMA domain containing 2
  • HORMA domain-containing protein 2
  • MGC26710

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85401
Species: Hu
Applications: IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58172
Species: Hu
Applications: WB
NBP2-46198
Species: Hu
Applications: WB, IHC
H00010459-D01P
Species: Hu
Applications: WB, ELISA
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55940
Species: Hu
Applications: ICC/IF
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-82724
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HORMAD2 Antibody (NBP1-82724) (0)

There are no publications for HORMAD2 Antibody (NBP1-82724).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HORMAD2 Antibody (NBP1-82724) (0)

There are no reviews for HORMAD2 Antibody (NBP1-82724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HORMAD2 Antibody (NBP1-82724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HORMAD2 Products

Bioinformatics Tool for HORMAD2 Antibody (NBP1-82724)

Discover related pathways, diseases and genes to HORMAD2 Antibody (NBP1-82724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HORMAD2 Antibody (NBP1-82724)

Discover more about diseases related to HORMAD2 Antibody (NBP1-82724).
 

Pathways for HORMAD2 Antibody (NBP1-82724)

View related products by pathway.

PTMs for HORMAD2 Antibody (NBP1-82724)

Learn more about PTMs related to HORMAD2 Antibody (NBP1-82724).

Blogs on HORMAD2

There are no specific blogs for HORMAD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HORMAD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HORMAD2