![Western Blot: HORMAD2 Antibody [NBP1-82724] - Analysis in control (vector only transfected HEK293T lysate) and HORMAD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/HORMAD2-Antibody-Western-Blot-NBP1-82724-img0010.jpg "Western Blot: HORMAD2 Antibody [NBP1-82724] - Analysis in control (vector only transfected HEK293T lysate) and HORMAD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit HORMAD2 Antibody - BSA Free (NBP1-82724) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HORMAD2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HORMAD2 |
![Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human prostate shows no cytoplasmic positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/HORMAD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82724-img0014.jpg "Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human prostate shows no cytoplasmic positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/HORMAD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82724-img0007.jpg "Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Analysis in human testis and endometrium tissues using NBP1-82724 antibody. Corresponding HORMAD2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HORMAD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82724-img0011.jpg "Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Analysis in human testis and endometrium tissues using NBP1-82724 antibody. Corresponding HORMAD2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human endometrium shows no cytoplasmic positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/HORMAD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82724-img0012.jpg "Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human endometrium shows no cytoplasmic positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human fallopian tube shows no cytoplasmic positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/HORMAD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82724-img0013.jpg "Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human fallopian tube shows no cytoplasmic positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells and weaker nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/HORMAD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82724-img0015.jpg "Immunohistochemistry-Paraffin: HORMAD2 Antibody [NBP1-82724] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells and weaker nuclear positivity in cells in seminiferous ducts.")
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")