TSEN54 Antibody

Images

 
Western Blot: TSEN54 Antibody [NBP2-30377] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry: TSEN54 Antibody [NBP2-30377] - Staining of human kidney shows moderate positivity in renal tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSEN54 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TTHLPDGGVRLLEKSGGLEIIFDVYQADAVATFRKNNPGKPYARMCISGFDEPVPDLCSLKRLSYQSGDVPLIFALVDHGDISFYSFRDFTLPQDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSEN54
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TSEN54 Protein (NBP2-30377PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSEN54 Antibody

  • hsSen54
  • PCH2A
  • PCH4
  • SEN54 homolog
  • sen54
  • SEN54FLJ37147
  • SEN54L
  • tRNA splicing endonuclease 54 homolog (S. cerevisiae)
  • tRNA splicing endonuclease 54 homolog (SEN54, S. cerevisiae)
  • tRNA-intron endonuclease Sen54
  • tRNA-splicing endonuclease subunit Sen54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00079042-B01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-85822
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
423-F8/CF
Species: Hu, Mu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF

Publications for TSEN54 Antibody (NBP2-30377) (0)

There are no publications for TSEN54 Antibody (NBP2-30377).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSEN54 Antibody (NBP2-30377) (0)

There are no reviews for TSEN54 Antibody (NBP2-30377). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSEN54 Antibody (NBP2-30377) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSEN54 Products

Bioinformatics Tool for TSEN54 Antibody (NBP2-30377)

Discover related pathways, diseases and genes to TSEN54 Antibody (NBP2-30377). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSEN54 Antibody (NBP2-30377)

Discover more about diseases related to TSEN54 Antibody (NBP2-30377).
 

Pathways for TSEN54 Antibody (NBP2-30377)

View related products by pathway.

Blogs on TSEN54

There are no specific blogs for TSEN54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSEN54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSEN54
Uniprot