HORMAD1 Antibody

Images

 
Immunohistochemistry-Paraffin: HORMAD1 Antibody [NBP1-85401] - Staining of human skin shows cytoplasmic positivity in a subset of squamous epithelial cells.
Immunohistochemistry-Paraffin: HORMAD1 Antibody [NBP1-85401] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: HORMAD1 Antibody [NBP1-85401] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HORMAD1 Antibody [NBP1-85401] - Staining in human testis and cerebral cortex tissues.. Corresponding HORMAD1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HORMAD1 Antibody [NBP1-85401] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HORMAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSESKTRSGKVFQNKMANGNQPVKSSKENRKRSQHESGRIVLHHFDSSSQESVPKRRKFSEPK
Specificity
Specificity of human HORMAD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HORMAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
ICC/IF reported in scientific literature (PMID: 25770156). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HORMAD1 Protein (NBP1-85401PEP)
Publications
Read Publications using
NBP1-85401 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HORMAD1 Antibody

  • Cancer/testis antigen 46
  • CT46DKFZP434A1315
  • HORMA domain containing 1
  • HORMA domain-containing protein 1
  • Newborn ovary HORMA protein
  • NOHMADKFZp434A1315

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB300-232
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-82724
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-229
Species: Mu, Rt, Ch, Ma, Pm, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-47258
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58172
Species: Hu, Mu
Applications: WB
NBP2-94045
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-207
Species: Hu, Mu, Ce
Applications: WB, IHC, IHC-P, IP
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-262
Species: Hu
Applications: WB, IP
NBP1-90989
Species: Hu
Applications: WB, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-85401
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HORMAD1 Antibody (NBP1-85401)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HORMAD1 Antibody (NBP1-85401) (0)

There are no reviews for HORMAD1 Antibody (NBP1-85401). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HORMAD1 Antibody (NBP1-85401) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HORMAD1 Products

Bioinformatics Tool for HORMAD1 Antibody (NBP1-85401)

Discover related pathways, diseases and genes to HORMAD1 Antibody (NBP1-85401). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HORMAD1 Antibody (NBP1-85401)

Discover more about diseases related to HORMAD1 Antibody (NBP1-85401).
 

Pathways for HORMAD1 Antibody (NBP1-85401)

View related products by pathway.

PTMs for HORMAD1 Antibody (NBP1-85401)

Learn more about PTMs related to HORMAD1 Antibody (NBP1-85401).

Blogs on HORMAD1

There are no specific blogs for HORMAD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HORMAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HORMAD1