THOC2 Antibody - BSA Free

Western Blot: THOC2 Antibody [NBP1-92500] - Analysis in human cell line SiHa.

Immunohistochemistry-Paraffin: THOC2 Antibody [NBP1-92500] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: THOC2 Antibody [NBP1-92500] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: THOC2 Antibody [NBP1-92500] - Staining of human kidney shows strong nuclear positivity in cells in tubules and glomeruli.

Immunohistochemistry-Paraffin: THOC2 Antibody [NBP1-92500] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Analysis in human cell line SiHa.

Staining of human cell line MCF7 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

THOC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit THOC2 Antibody - BSA Free (NBP1-92500) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-THOC2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKDPPPRNAVASV
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THOC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  THOC2 Protein (NBP1-92500PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for THOC2 Antibody - BSA Free

• CXorf3
• dJ506G2.1
• hTREX120
• THO complex 2
• THO complex subunit 2

Background

THO2 is part of the TREX (transcription/export) complex, which includes TEX1 (MIM 606929), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for THOC2 Antibody (NBP1-92500)(1)

Publication using NBP1-92500

• Polenkowski M, Allister AB, Burbano de Lara S et al. THOC5 complexes with DDX5, DDX17, and CDK12 to regulate R loop structures and transcription elongation rate iScience 2023-01-20 [PMID: 36590164]

Bioinformatics

• Gene Symbol: THOC2