GPM6B Antibody

Images

 
Immunohistochemistry-Paraffin: GPM6B Antibody [NBP1-81271] - Staining of human hippocampus shows distinct positivity in neuropil.
Flow Cytometry: GPM6B Antibody [NBP1-81271] - Analysis of GPM6B in human fibroblast cells using anti-GPM6B antibody. Image courtesy of Rebecca Leylek at Stanford University.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications Flow, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPM6B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPM6B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. GPM6B antibody validated for Flow from a verified customer review.
Control Peptide
GPM6B Protein (NBP1-81271PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-81271 in the following applications:

Publications
Read Publication using NBP1-81271.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23284715)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPM6B Antibody

  • glycoprotein M6B
  • M6b
  • M6Bneuronal membrane glycoprotein M6-b
  • MGC17150
  • MGC54284
  • protolipid M6B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-85000
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00056339-B01P
Species: Hu, Pm, Mu
Applications: ICC/IF, WB
NBP2-35224
Species: Hu
Applications: Func, PAGE
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-27461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
AF144
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00000395-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB2688
Species: Hu
Applications: WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92500
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NB110-41622
Species: Bv, Ch, Gt, Hu, Mu, Po, Rt, Xp
Applications: IHC, IHC-P, WB

Publications for GPM6B Antibody (NBP1-81271)(1)

Review for GPM6B Antibody (NBP1-81271) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-81271:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry GPM6B NBP1-81271
Enlarge
4
reviewed by:
Verified Customer
Flow Human 09/17/2015
View

Summary

ApplicationFlow Cytometry
Sample Testedfibroblast cells
SpeciesHuman

Blocking

Blocking Detailsn/a

Primary Anitbody

Dilution Ratio1:30

Secondary Antibody

Secondary Descriptionmouse anti-rabbit fluorescent conjugated secondary antibody

Details

Detection Notesn/a

Comments

CommentsImage submitted by Rebecca Leylek at Stanford University. Human fibroblast cells were used for intracellular staining with a FoxP3 fix/perm protocol. A mouse anti-rabbit secondary fluorescent antibody was used to detect the primary antibody. Detected a positive signal that seems to be target-specific binding. In the figure, the sample labeled “Tube_001” was stained with the GPM6B primary antibody at a dilution of 1/30 as well as the secondary antibody. The sample labeled “Tube_002” had the secondary antibody but no primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPM6B Antibody (NBP1-81271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPM6B Products

Bioinformatics Tool for GPM6B Antibody (NBP1-81271)

Discover related pathways, diseases and genes to GPM6B Antibody (NBP1-81271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPM6B Antibody (NBP1-81271)

Discover more about diseases related to GPM6B Antibody (NBP1-81271).
 

Pathways for GPM6B Antibody (NBP1-81271)

View related products by pathway.

PTMs for GPM6B Antibody (NBP1-81271)

Learn more about PTMs related to GPM6B Antibody (NBP1-81271).
 

Research Areas for GPM6B Antibody (NBP1-81271)

Find related products by research area.

Blogs on GPM6B

There are no specific blogs for GPM6B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
09/17/2015
Application: Flow
Species: Human

Bioinformatics

Gene Symbol GPM6B