THOC3 Antibody - BSA Free

Western Blot: THOC3 Antibody [NBP1-92502] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: THOC3 Antibody [NBP1-92502] - Staining of human colon shows strong granular cytoplasmic and nuclear positivity in glandular cells.

Western Blot: THOC3 Antibody [NBP1-92502] - Analysis in human cell line PC-3.

Western Blot: THOC3 Antibody [NBP1-92502] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: THOC3 Antibody [NBP1-92502] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: THOC3 Antibody [NBP1-92502] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: THOC3 Antibody [NBP1-92502] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human colon shows strong nuclear positivity in glandular cells.

Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Analysis in human cell line PC-3.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

THOC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit THOC3 Antibody - BSA Free (NBP1-92502) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THOC3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  THOC3 Protein (NBP1-92502PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for THOC3 Antibody - BSA Free

• hTREX45
• MGC5469
• TEX1 homolog
• TEX1THO complex subunit 3
• THO complex 3
• tho3

Background

TEX1 is part of the TREX (transcription/export) complex, which includes THO2 (MIM 300395), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THOC3