AASDH Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AASDH Antibody [NBP1-89266] - Staining of human cell line U-2 OS shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: AASDH Antibody [NBP1-89266] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AASDH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKLSDINQEEASGTSLHQKAIMTFTCHNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLKGLNSPVLIGKSKDPSCV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AASDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AASDH Protein (NBP1-89266PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AASDH Antibody

  • ACSF4acyl-CoA synthetase family member 4
  • aminoadipate-semialdehyde dehydrogenase
  • EC 6.2.1.-
  • LYS2
  • non-ribosomal peptide synthetase 1098
  • non-ribosomal peptide synthetase 998,2-aminoadipic 6-semialdehyde dehydrogenase
  • NRPS1098
  • NRPS998
  • Protein NRPS998
  • U26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89322
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00008847-P01
Species: Hu
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-60949
Species: AB, Bv, Gt, Sh, WB
Applications: Flow, Func, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-83906
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE

Publications for AASDH Antibody (NBP1-89266) (0)

There are no publications for AASDH Antibody (NBP1-89266).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AASDH Antibody (NBP1-89266) (0)

There are no reviews for AASDH Antibody (NBP1-89266). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AASDH Antibody (NBP1-89266) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AASDH Products

Bioinformatics Tool for AASDH Antibody (NBP1-89266)

Discover related pathways, diseases and genes to AASDH Antibody (NBP1-89266). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AASDH Antibody (NBP1-89266)

Discover more about diseases related to AASDH Antibody (NBP1-89266).

Blogs on AASDH

There are no specific blogs for AASDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AASDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AASDH
Entrez
Uniprot