ALG1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALG1 Antibody [NBP2-32539] - Staining of human cell line Hep G2 shows localization to nucleoli fibrillar center & endoplasmic reticulum.
Immunohistochemistry-Paraffin: ALG1 Antibody [NBP2-32539] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts, Leydig cells shows moderate staining.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALG1 Protein (NBP2-32539PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG1 Antibody

  • asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase)
  • asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 1 homolog
  • beta-1,4 mannosyltransferase
  • beta-1,4-mannosyltransferase
  • chitobiosyldiphosphodolichol beta-mannosyltransferase
  • GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase
  • GDP-mannose-dolichol diphosphochitobiose mannosyltransferase
  • hMat-1
  • HMAT1EC 2.4.1.142
  • HMT-1
  • HMT1CDG1K
  • mannosyltransferase-1
  • MT-1

Background

The biosynthesis of lipid-linked oligosaccharides is highly conserved among eukaryotes and is catalyzed by 14 glycosyltransferases in an ordered stepwise manner. Mannosyltransferase I (MT I) catalyzes the first mannosylation step in this process.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004502-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-89772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
NBP1-97493
Species: Eq, Fi, Hu, Mu, Rb, Rt
Applications: ELISA, IHC, IHC-P, WB
H00004493-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBL1-13348
Species: Hu
Applications: WB
H00004496-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00004494-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00004495-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-05957
Species: Hu
Applications: WB
M6000B
Species: Mu
Applications: ELISA
NB100-77417
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
NBP2-10437
Species: Hu
Applications: WB
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC

Publications for ALG1 Antibody (NBP2-32539) (0)

There are no publications for ALG1 Antibody (NBP2-32539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG1 Antibody (NBP2-32539) (0)

There are no reviews for ALG1 Antibody (NBP2-32539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALG1 Antibody (NBP2-32539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG1