Themis Antibody

Images

 
Western Blot: Themis Antibody [NBP1-90802] - Analysis in human cell line Jurkat.
Immunohistochemistry-Paraffin: Themis Antibody [NBP1-90802] - Staining of human tonsil shows strong granular cytoplasmic positivity in germinal center cells and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Themis Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THEMIS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Themis Protein (NBP1-90802PEP)
Publications
Read Publication using NBP1-90802.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25535246)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Themis Antibody

  • bA325O24.3
  • bA325O24.4
  • C6orf190
  • C6orf207
  • FLJ40584
  • Gasp
  • GRB2-associated protein
  • MGC163388
  • protein THEMIS
  • signaling phosphoprotein specific for T cells
  • SPOT
  • Themis
  • thymocyte selection associated
  • thymocyte selection pathway associated
  • thymocyte-expressed molecule involved in selection
  • TSEPA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59448
Species: Hu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83391
Species: Hu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF6574
Species: Mu
Applications: WB
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for Themis Antibody (NBP1-90802)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-90802 Applications Species
Paster W, Bruger AM, Katsch K et al. A THEMIS:SHP1 complex promotes T-cell survival. EMBO J 2015 Feb 3 [PMID: 25535246]

Reviews for Themis Antibody (NBP1-90802) (0)

There are no reviews for Themis Antibody (NBP1-90802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Themis Antibody (NBP1-90802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Themis Products

Bioinformatics Tool for Themis Antibody (NBP1-90802)

Discover related pathways, diseases and genes to Themis Antibody (NBP1-90802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Themis Antibody (NBP1-90802)

Discover more about diseases related to Themis Antibody (NBP1-90802).
 

Pathways for Themis Antibody (NBP1-90802)

View related products by pathway.

PTMs for Themis Antibody (NBP1-90802)

Learn more about PTMs related to Themis Antibody (NBP1-90802).

Blogs on Themis

There are no specific blogs for Themis, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Themis Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THEMIS
Entrez