THRSP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: THRSP Antibody [NBP1-81290] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: THRSP Antibody [NBP1-81290] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: THRSP Antibody [NBP1-81290] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: THRSP Antibody [NBP1-81290] - Staining of human breast shows strong nuclear and cytoplasmic positivity in adipocytes.
Immunohistochemistry-Paraffin: THRSP Antibody [NBP1-81290] - Staining of human endometrium shows no cytoplasmic positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: THRSP Antibody [NBP1-81290] - Staining of human salivary gland shows moderate cytoplasmic positivity in glandular cells and adipocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THRSP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THRSP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
THRSP Protein (NBP1-81290PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for THRSP Antibody

  • lipogenic protein 1
  • Lpgp
  • LPGP1
  • S14
  • S14MGC21659
  • Spot 14 protein
  • SPOT14
  • SPOT14SPOT14 homolog
  • THRSP
  • thyroid hormone responsive (SPOT14 homolog, rat)
  • thyroid hormone responsive SPOT14 (rat) homolog
  • thyroid hormone responsive SPOT14
  • thyroid hormone responsive
  • thyroid hormone-inducible hepatic protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-75649
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-67301
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP1-81545
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-22289
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-93953
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for THRSP Antibody (NBP1-81290) (0)

There are no publications for THRSP Antibody (NBP1-81290).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THRSP Antibody (NBP1-81290) (0)

There are no reviews for THRSP Antibody (NBP1-81290). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for THRSP Antibody (NBP1-81290) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional THRSP Products

Bioinformatics Tool for THRSP Antibody (NBP1-81290)

Discover related pathways, diseases and genes to THRSP Antibody (NBP1-81290). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THRSP Antibody (NBP1-81290)

Discover more about diseases related to THRSP Antibody (NBP1-81290).
 

Pathways for THRSP Antibody (NBP1-81290)

View related products by pathway.

PTMs for THRSP Antibody (NBP1-81290)

Learn more about PTMs related to THRSP Antibody (NBP1-81290).

Blogs on THRSP

There are no specific blogs for THRSP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THRSP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THRSP