Th-POK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Th-POK Antibody [NBP1-88078] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Th-POK Antibody [NBP1-88078] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Th-POK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB7B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Th-POK Protein (NBP1-88078PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Th-POK Antibody

  • c-Krox
  • hcKroxc-Krox
  • Krueppel-related zinc finger protein cKrox
  • kruppel-related zinc finger protein hcKrox
  • T-helper-inducing POZ/Krueppel-like factor
  • ThPOK
  • Th-POK
  • ZBTB15
  • ZBTB15zinc finger protein 67 homolog (mouse)
  • ZBTB7B
  • ZFP67
  • zfp-67
  • zinc finger and BTB domain containing 15
  • zinc finger and BTB domain containing 7B
  • Zinc finger and BTB domain-containing protein 15
  • zinc finger and BTB domain-containing protein 7B
  • Zinc finger protein 67 homolog
  • Zinc finger protein 857B
  • Zinc finger protein Th-POK
  • ZNF857B
  • ZNF857BDKFZp686G01254

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4256
Species: Hu
Applications: WB
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-23673
Species: Hu, Mu, Rt, Ch, Op
Applications: WB, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-58529
Species: Hu
Applications: ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Th-POK Antibody (NBP1-88078) (0)

There are no publications for Th-POK Antibody (NBP1-88078).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Th-POK Antibody (NBP1-88078) (0)

There are no reviews for Th-POK Antibody (NBP1-88078). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Th-POK Antibody (NBP1-88078) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Th-POK Products

Bioinformatics Tool for Th-POK Antibody (NBP1-88078)

Discover related pathways, diseases and genes to Th-POK Antibody (NBP1-88078). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Th-POK Antibody (NBP1-88078)

Discover more about diseases related to Th-POK Antibody (NBP1-88078).
 

Pathways for Th-POK Antibody (NBP1-88078)

View related products by pathway.

PTMs for Th-POK Antibody (NBP1-88078)

Learn more about PTMs related to Th-POK Antibody (NBP1-88078).

Blogs on Th-POK

There are no specific blogs for Th-POK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Th-POK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB7B
Entrez