Th-POK Antibody - BSA Free

Staining of human cell line U-251 MG shows localization to nucleoplasm.

Staining of human cerebral cortex, liver, lymph node and small intestine using Anti-ZBTB7B antibody NBP1-88078 (A) shows similar protein distribution across tissues to independent antibody NBP1-88077 (B).

Analysis in human small intestine and liver tissues using HPA025820 antibody. Corresponding ZBTB7B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Th-POK Antibody [NBP1-88078] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: Th-POK Antibody [NBP1-88078] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Th-POK Antibody [NBP1-88078] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: Th-POK Antibody [NBP1-88078] - Staining of human lymph node shows moderate nuclear positivity in a subset of non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Th-POK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Th-POK Antibody - BSA Free (NBP1-88078) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKG
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBTB7B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Th-POK Recombinant Protein Antigen (NBP1-88078PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Th-POK Antibody - BSA Free

• c-Krox
• hcKroxc-Krox
• Krueppel-related zinc finger protein cKrox
• kruppel-related zinc finger protein hcKrox
• T-helper-inducing POZ/Krueppel-like factor
• ThPOK
• Th-POK
• ZBTB15
• ZBTB15zinc finger protein 67 homolog (mouse)
• ZBTB7B
• ZFP67
• zfp-67
• zinc finger and BTB domain containing 15
• zinc finger and BTB domain containing 7B
• Zinc finger and BTB domain-containing protein 15
• zinc finger and BTB domain-containing protein 7B
• Zinc finger protein 67 homolog
• Zinc finger protein 857B
• Zinc finger protein Th-POK
• ZNF857B
• ZNF857BDKFZp686G01254

Background

ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZBTB7B