TGF-beta RIII Antibody

Images

 
Immunohistochemistry-Paraffin: TGF-beta RIII Antibody [NBP1-89988] - Staining of human kidney shows medium membranous positivity in cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TGF-beta RIII Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGFBR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TGF-beta RIII Protein (NBP1-89988PEP)
Publications
Read Publications using
NBP1-89988 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24658685)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TGF-beta RIII Antibody

  • betaglycan proteoglycan
  • Betaglycan
  • BGCAN
  • TBRIII
  • TGF-beta receptor type 3
  • TGF-beta receptor type III
  • TGF-beta RIII
  • TGFbetaRIII
  • TGFBR3
  • TGF-bRIII
  • TGFR-3
  • Transforming growth factor beta receptor III
  • transforming growth factor beta receptor type 3
  • transforming growth factor, beta receptor III (betaglycan, 300kDa)
  • transforming growth factor, beta receptor III

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
302-B2/CF
Species: Hu
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP1-89988
Species: Hu
Applications: IHC, IHC-P

Publications for TGF-beta RIII Antibody (NBP1-89988)(3)

Reviews for TGF-beta RIII Antibody (NBP1-89988) (0)

There are no reviews for TGF-beta RIII Antibody (NBP1-89988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TGF-beta RIII Antibody (NBP1-89988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TGF-beta RIII Products

Bioinformatics Tool for TGF-beta RIII Antibody (NBP1-89988)

Discover related pathways, diseases and genes to TGF-beta RIII Antibody (NBP1-89988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TGF-beta RIII Antibody (NBP1-89988)

Discover more about diseases related to TGF-beta RIII Antibody (NBP1-89988).
 

Pathways for TGF-beta RIII Antibody (NBP1-89988)

View related products by pathway.

PTMs for TGF-beta RIII Antibody (NBP1-89988)

Learn more about PTMs related to TGF-beta RIII Antibody (NBP1-89988).
 

Research Areas for TGF-beta RIII Antibody (NBP1-89988)

Find related products by research area.

Blogs on TGF-beta RIII.

TGF-beta RIII - a high affinity reservoir for TGF-beta I/II ligands with therapeutic potential
TGF beta (transforming growth factor beta) is a superfamily of cytokines that participate in a variety of cellular processes including growth, proliferation, differentiation, and apoptosis. There are 3 classes of receptors for TGF beta cytokines an...  Read full blog post.

TGF-beta RIII - A multi-functional regulator of the TGF-beta signaling pathway
Transforming growth factor-beta receptor III (TGF-beta RIII) is one of three receptors for the secreted growth factor TGF-beta. Unlike type I and type II TGF-beta receptors, TGF-beta RIII does not participate directly in the propagation of intracel...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TGF-beta RIII Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGFBR3
Entrez