| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TGF-beta RIII Antibody - BSA Free (NBP1-89988) is a polyclonal antibody validated for use in IHC. Anti-TGF-beta RIII Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TGFBR3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TGF-beta RIII Antibody (NBP1-89988)Find related products by research area.
|
|
TGF-beta RIII - a high affinity reservoir for TGF-beta I/II ligands with therapeutic potential TGF beta (transforming growth factor beta) is a superfamily of cytokines that participate in a variety of cellular processes including growth, proliferation, differentiation, and apoptosis. There are 3 classes of receptors for TGF beta cytokines an... Read full blog post. |
|
TGF-beta RIII - A multi-functional regulator of the TGF-beta signaling pathway Transforming growth factor-beta receptor III (TGF-beta RIII) is one of three receptors for the secreted growth factor TGF-beta. Unlike type I and type II TGF-beta receptors, TGF-beta RIII does not participate directly in the propagation of intracel... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TGFBR3 |