TGDS Antibody

Images

 
Immunohistochemistry-Paraffin: TGDS Antibody [NBP1-87064] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TGDS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVEAFLTVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGDS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TGDS Protein (NBP1-87064PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TGDS Antibody

  • dTDP-D-glucose 4,6-dehydratase
  • EC 4.2.1.46
  • growth-inhibiting protein 21
  • P
  • SDR2E1
  • short chain dehydrogenase/reductase family 2E, member 1
  • TDPGD
  • TDP-glucose 4,6-dehydratase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87066
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
7559-ST
Species: Hu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01184
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TGDS Antibody (NBP1-87064) (0)

There are no publications for TGDS Antibody (NBP1-87064).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGDS Antibody (NBP1-87064) (0)

There are no reviews for TGDS Antibody (NBP1-87064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TGDS Antibody (NBP1-87064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TGDS Products

Bioinformatics Tool for TGDS Antibody (NBP1-87064)

Discover related pathways, diseases and genes to TGDS Antibody (NBP1-87064). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TGDS Antibody (NBP1-87064)

Discover more about diseases related to TGDS Antibody (NBP1-87064).

Blogs on TGDS

There are no specific blogs for TGDS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TGDS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGDS