MGC4172 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MGC4172 Antibody [NBP2-30446] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MGC4172 Antibody [NBP2-30446] - Staining in human duodenum and lymph node tissues using anti-DHRS11 antibody. Corresponding DHRS11 RNA-seq data are presented ...read more
Immunohistochemistry: MGC4172 Antibody [NBP2-30446] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MGC4172 Antibody [NBP2-30446] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: MGC4172 Antibody [NBP2-30446] - Staining of human lymph node shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MGC4172 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTE
Specificity
Specificity of human MGC4172 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHRS11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MGC4172 Protein (NBP2-30446PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MGC4172 Antibody

  • ARPG836
  • dehydrogenase/reductase (SDR family) member 11
  • dehydrogenase/reductase SDR family member 11
  • FLJ39232
  • MGC4172
  • SDR24C1
  • short chain dehydrogenase/reductase family 24C, member 1
  • short-chain dehydrogenase/reductase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5759
Species: Hu, Mu
Applications: WB
NBP2-02164
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90232
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32431
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89378
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02431
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87117
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MGC4172 Antibody (NBP2-30446) (0)

There are no publications for MGC4172 Antibody (NBP2-30446).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGC4172 Antibody (NBP2-30446) (0)

There are no reviews for MGC4172 Antibody (NBP2-30446). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MGC4172 Antibody (NBP2-30446) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MGC4172 Products

Bioinformatics Tool for MGC4172 Antibody (NBP2-30446)

Discover related pathways, diseases and genes to MGC4172 Antibody (NBP2-30446). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MGC4172 Antibody (NBP2-30446)

Find related products by research area.

Blogs on MGC4172

There are no specific blogs for MGC4172, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGC4172 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHRS11
Uniprot