TFII-I Antibody - BSA Free

Western Blot: TFII-I Antibody [NBP3-38482] - Western blot analysis of lysates from mouse brain, using TFII-I Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.

Immunohistochemistry: TFII-I Antibody [NBP3-38482] - Immunohistochemistry analysis of paraffin-embedded Rat brain using TFII-I Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: TFII-I Antibody [NBP3-38482] - Western blot analysis of lysates from BT-474 cells, using TFII-I Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry: TFII-I Antibody [NBP3-38482] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using TFII-I Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: TFII-I Antibody [NBP3-38482] - Immunohistochemistry analysis of paraffin-embedded Human esophagus using TFII-I Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: TFII-I Antibody [NBP3-38482] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using TFII-I Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TFII-I Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-810 of human TFII-I (NP_001157108.1).
  
  Sequence:
  TWFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASKINTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSAVRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTSSKSPPRKINSSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTF2I
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 112 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TFII-I Antibody - BSA Free

• BAP-135,135kD
• BAP135WBS
• Bruton tyrosine kinase-associated protein 135
• BTKAP1
• DIWS
• FLJ38776
• FLJ56355
• general transcription factor II, i
• general transcription factor IIi
• general transcription factor II-I
• GTFII-I
• IB291
• SPINBTK-associated protein 135
• TFII-ISRF-Phox1-interacting protein
• WBSCR6
• Williams-Beuren syndrome chromosome region 6

Background

TFII-I encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. The exon(s) encoding 5' UTR has not been fully defined, but this gene is known to contain at least 34 exons, and its alternative splicing generates 4 transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTF2I