Tetraspanin-4 Antibody - Azide and BSA Free

Western Blot: Tetraspanin-4 Antibody [NBP2-93365] - Analysis of extracts of various cell lines, using Tetraspanin-4 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 15s.

Western blot analysis of PC-3, using Tetraspanin-4 antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Tetraspanin-4 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Tetraspanin-4 (NP_003262.1). IAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPAN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Tetraspanin-4 Antibody - Azide and BSA Free

• NAG2
• Novel antigen 2
• TETRASPAN
• tetraspanin 4
• Tetraspanin-4
• TM4SF7
• Transmembrane 4 superfamily member 7NAG-2NAG2TM4SF7tetraspan TM4SF
• TSPAN4
• TSPAN-4

Background

Tetraspanin-4 is encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified. Transcript Variant: This variant (3) differs in the 5' UTR, compared to variant 1. Variants 1, 2, 3, 4, 5 and 6 encode the same isoform (a).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tetraspanin-4 Antibody (NBP2-93365)(1)

Publication using NBP2-93365

• Tatsuro Egawa, Takeshi Ogawa, Takumi Yokokawa, Kohei Kido, Ryota Iyama, Haiyu Zhao, Eriko Kurogi, Katsumasa Goto, Tatsuya Hayashi Glycative stress inhibits hypertrophy and impairs cell membrane integrity in overloaded mouse skeletal muscle. Journal of cachexia, sarcopenia and muscle 2024-04-04 [PMID: 38575520]

Bioinformatics

• Gene Symbol: TSPAN4