PERP Antibody (1O3L5)

Western Blot: PERP Antibody (1O3L5) [NBP3-16617] - Western blot analysis of extracts of various cell lines, using PERP Rabbit mAb (NBP3-16617) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: PERP Antibody (1O3L5) [NBP3-16617] - Immunohistochemistry of paraffin-embedded rat skin using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: PERP Antibody (1O3L5) [NBP3-16617] - Immunohistochemistry of paraffin-embedded mouse skin using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of human skin cells using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [PERP] - Immunofluorescence analysis of paraffin-embedded human skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1O3L5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PERP Antibody (1O3L5) Summary

• Description: Novus Biologicals Rabbit PERP Antibody (1O3L5) (NBP3-16617) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 94-193 of human PERP (Q96FX8). LSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PERP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PERP Antibody (1O3L5)

• dJ496H19.1
• KCP1KCP-1
• Keratinocyte-associated protein 1
• KRTCAP11110017A08Rik
• p53 apoptosis effector related to PMP22
• p53 apoptosis effector related to PMP-22
• P53-induced protein PIGPC1
• PERP, TP53 apoptosis effector
• PIGPC1RP3-496H19.1
• THWkeratinocytes associated protein 1
• Transmembrane protein THW

Background

The p53 tumor suppressor activates either cell cycle arrest or apoptosis in response to cellular stress. A novel gene, PERP, is expressed in a p53-dependent manner and at high levels in apoptotic cells compared with G(1)-arrested cells. PERP induction is linked to p53-dependent apoptosis and is directly activated by p53. These data suggest that PERP is a novel effector of p53-dependent apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PERP