Tetraspanin-31 Antibody - BSA Free

Immunohistochemistry-Paraffin: Tetraspanin-31 Antibody [NBP2-33838] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tetraspanin-31 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tetraspanin-31 Antibody - BSA Free (NBP2-33838) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPAN31
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tetraspanin-31 Protein (NBP2-33838PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tetraspanin-31 Antibody - BSA Free

• sarcoma amplified sequence
• Sarcoma-amplified sequence
• SAS
• SAStransmembrane 4 protein
• tetraspanin 31
• Tetraspanin-31
• Transmembrane 4 Protein
• TSPAN31
• tspan-31

Background

The protein encoded by the Tetraspanin-31 gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSPAN31
• Uniprot:
  • Q12999(Human)