TET3 Antibody - Azide and BSA Free

Western Blot: TET3 Antibody [NBP2-93429] - Western blot analysis of extracts of mESCs cells, using TET3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TET3 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1551-1650 of human TET3 (NP_001274420.1). GFQDKLWNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TET3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TET3 Antibody - Azide and BSA Free

• EC 1.14.11.n2
• hCG_40738
• KIAA0401
• methylcytosine dioxygenase TET3
• MGC22014
• probable methylcytosine dioxygenase TET3
• tet oncogene family member 3

Background

TET3 may catalyze the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TET3