Tensin 1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LSPLTNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TNS1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Tensin 1 Antibody - BSA Free
Background
Tensin 1 (TNS1, human Tensin 1 theoretical molecular weight 186kDa) belongs to a family of focal adhesion proteins which in mammals includes three other members: Tensin 2, Tensin 3, and C-terminal tensin-like (Cten or Tensin 4) (1, 2). Tensins localize to focal adhesion sites, which are functional domains of the cellular membrane that mediate interactions between the actin cytoskeleton and the extracellular matrix (1). Transmembrane integrin receptors (alpha-beta heterodimer) predominate within focal adhesions and serve to bridge the interactions between extracellular components and the cytoskeleton (3). Tensin 1 interacts with both actin filaments and beta-integrin receptors within focal adhesion sites to mediate cellular responses to extracellular signals (1, 4). Several common functional domains are shared between some tensin family members including: 1) amino terminal PTEN-related tyrosine phosphatase (PTP) domain, 2) amino terminal actin-binding (ABD-1) domain, 3) amino terminal focal adhesion binding (FAB-N) domain, 4) carboxy terminal Src homology 2 (SH2) domain, 5) carboxy terminal phosphotyrosine binding (PTB) domain, and 6) carboxy terminal focal adhesion binding (FAB-C) domain (4). The PTB domain allows tensins to interact with beta-integrin cytoplasmic tails, while their SH2 domain supports interaction with tyrosine-phosphorylated signaling proteins (1). The interactions of tensins with focal adhesion kinases and phosphatases support diverse cellular processes such as attachment, migration, and polarization. Loss of function studies have revealed that tensin 1 plays a critical role for normal kidney function, skeletal muscle regeneration and angiogenesis (1).
References
1. Lo, S. H. (2017). Tensins. Current Biology. https://doi.org/10.1016/j.cub.2017.02.041
2. Lo, S. H. (2014). C-terminal tensin-like (CTEN): A promising biomarker and target for cancer. International Journal of Biochemistry and Cell Biology. https://doi.org/10.1016/j.biocel.2014.04.003
3. Armitage, S. K., & Plotnikov, S. V. (2016). Bridging the gap: A new study reveals that a protein called talin forms a vital link between microtubules and focal adhesions at the surface of cells. ELife. https://doi.org/10.7554/eLife.19733
4. Lo, S. H. (2006). Focal adhesions: What's new inside. Developmental Biology. https://doi.org/10.1016/j.ydbio.2006.03.029
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC, Mycoplasma
Publications for Tensin 1 Antibody (NBP1-84130)(1)
Showing Publication 1 -
1 of 1.
| Publication using NBP1-84130 |
Applications |
Species |
| Qiuyu Martin Zhu, Yu-Han H Hsu, Frederik H Lassen, Bryan T MacDonald, Stephanie Stead, Edyta Malolepsza, April Kim, Taibo Li, Taiji Mizoguchi, Monica Schenone, Gaelen Guzman, Benjamin Tanenbaum, Nadine Fornelos, Steven A Carr, Rajat M Gupta, Patrick T Ellinor, Kasper Lage Protein interaction networks in the vasculature prioritize genes and pathways underlying coronary artery disease. Communications biology 2024-01-15 [PMID: 38216744] |
|
|
Reviews for Tensin 1 Antibody (NBP1-84130) (0)
There are no reviews for Tensin 1 Antibody (NBP1-84130).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Tensin 1 Antibody (NBP1-84130) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tensin 1 Products
Research Areas for Tensin 1 Antibody (NBP1-84130)
Find related products by research area.
|
Blogs on Tensin 1