TEM7/PLXDC1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLXDC1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (83%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TEM7/PLXDC1 Antibody - BSA Free
Background
Recently, using SAGE (Serial Analysis of Gene Expression) technology, St. Croix et al, have identified 46 genes, whose expression is specifically elevated in tumor-associated endothelium. Nine of these genes were prominently expressed only in tumor endothelial cells (EC), but were absent or barely detectable in normal ECs, and named as Tumor Endothelial Markers (TEMs, TEM 1-9). TEM7 (Tumor endothelial marker 7) transcripts are specifically expressed in the endothelium of colorectal cancer, primary cancers of lung, pancreas, breast, and brain. TEM7 is expressed specifically in endothelium of these cancers, whether primary or metastasis. The other six members of this family (TEM1, 3, 4, 5, 8, and 9) also show similar expression pattern in lung and brain tumors, and liver metastasis. Since most of the genes expressed differentially in tumor endothelium are also expressed during angiogenesis, these newly discovered genes might provide important resources for basic and clinical studies of human angiogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: IHC
Publications for TEM7/PLXDC1 Antibody (NBP1-86954) (0)
There are no publications for TEM7/PLXDC1 Antibody (NBP1-86954).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TEM7/PLXDC1 Antibody (NBP1-86954) (0)
There are no reviews for TEM7/PLXDC1 Antibody (NBP1-86954).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for TEM7/PLXDC1 Antibody (NBP1-86954) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TEM7/PLXDC1 Products
Research Areas for TEM7/PLXDC1 Antibody (NBP1-86954)
Find related products by research area.
|
Blogs on TEM7/PLXDC1