TCL1A Antibody - BSA Free

Western Blot: TCL1A Antibody [NBP1-54693] - Human Brain lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TCL1A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TCL1A(T-cell leukemia/lymphoma 1A) The peptide sequence was selected from the N terminal of TCL1A. Peptide sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCL1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 13 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TCL1A Antibody - BSA Free

• Oncogene TCL1
• Oncogene TCL-1
• Protein p14 TCL1
• T-cell leukemia/lymphoma 1A
• T-cell lymphoma-1
• T-cell lymphoma-1A
• TCL1A
• TCL1-PEN
• TCL1T-cell leukemia/lymphoma protein 1A

Background

TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3;promote nuclear translocation of AKT1;enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TCL1A Antibody (NBP1-54693)(1)

Publication using NBP1-54693

• Ho MF, Bongartz T, Liu M et al. Estrogen, SNP-Dependent Chemokine Expression and Selective Estrogen Receptor Modulator Regulation. Mol. Endocrinol. 2016-03-01 [PMID: 26866883] (WB, Human)
  
  Details:
  B7-H4 antibody was used at a dilution of 1:400 for the IHC-P analysis of tissues from ovarian cancer patients (serous cystadenocarcinoma and mucinous cystadenocarcinoma). The detection was performed using HRP labelled secondary and DAB reagent - see the full text for detailed protocol.

Bioinformatics

• Gene Symbol: TCL1A
• Uniprot:
  • P56279(Human)